Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   V5F96_RS02720 Genome accession   NZ_CP145059
Coordinates   520632..521105 (+) Length   157 a.a.
NCBI ID   WP_025455782.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain WHO_W_2024     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 521651..572177 520632..521105 flank 546


Gene organization within MGE regions


Location: 520632..572177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F96_RS02720 (V5F96_02720) pilL 520632..521105 (+) 474 WP_025455782.1 PilX family type IV pilin Machinery gene
  V5F96_RS02725 (V5F96_02725) - 521717..522162 (-) 446 Protein_527 AzlC family ABC transporter permease -
  V5F96_RS02730 (V5F96_02730) dut 522328..522780 (+) 453 WP_003690909.1 dUTP diphosphatase -
  V5F96_RS02735 (V5F96_02735) dapC 522858..524045 (+) 1188 WP_003690911.1 succinyldiaminopimelate transaminase -
  V5F96_RS02740 (V5F96_02740) yaaA 524201..524980 (+) 780 WP_003690913.1 peroxide stress protein YaaA -
  V5F96_RS02755 (V5F96_02755) - 525511..526707 (+) 1197 WP_003704323.1 integrase arm-type DNA-binding domain-containing protein -
  V5F96_RS02760 (V5F96_02760) - 527063..527332 (-) 270 WP_003687928.1 hypothetical protein -
  V5F96_RS02765 (V5F96_02765) - 527527..528210 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  V5F96_RS02770 (V5F96_02770) - 528524..528757 (-) 234 Protein_534 hypothetical protein -
  V5F96_RS02775 (V5F96_02775) - 528868..529083 (-) 216 WP_003691538.1 hypothetical protein -
  V5F96_RS02780 (V5F96_02780) - 529135..529626 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  V5F96_RS02785 (V5F96_02785) - 529623..529805 (-) 183 WP_003691535.1 hypothetical protein -
  V5F96_RS02790 (V5F96_02790) - 529945..530631 (-) 687 WP_003691532.1 phage replication initiation protein, NGO0469 family -
  V5F96_RS02795 (V5F96_02795) - 530700..530861 (-) 162 WP_003691530.1 hypothetical protein -
  V5F96_RS02800 (V5F96_02800) - 530858..531136 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  V5F96_RS02805 (V5F96_02805) - 531289..531621 (-) 333 WP_003691528.1 hypothetical protein -
  V5F96_RS02810 (V5F96_02810) - 531762..532043 (-) 282 WP_144998528.1 hypothetical protein -
  V5F96_RS02815 (V5F96_02815) - 532040..532516 (-) 477 WP_002255718.1 hypothetical protein -
  V5F96_RS02820 (V5F96_02820) - 532549..532749 (-) 201 WP_003692842.1 hypothetical protein -
  V5F96_RS02825 (V5F96_02825) - 532947..533360 (-) 414 WP_003687963.1 hypothetical protein -
  V5F96_RS02830 (V5F96_02830) - 533357..533818 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  V5F96_RS02835 (V5F96_02835) - 533835..534272 (-) 438 WP_003687967.1 hypothetical protein -
  V5F96_RS02840 (V5F96_02840) - 534387..535103 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  V5F96_RS02845 (V5F96_02845) - 535172..535408 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  V5F96_RS02850 (V5F96_02850) - 535488..535643 (+) 156 WP_047923772.1 hypothetical protein -
  V5F96_RS02855 (V5F96_02855) - 535620..535808 (-) 189 WP_047926457.1 hypothetical protein -
  V5F96_RS02860 (V5F96_02860) - 535982..536209 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  V5F96_RS02865 (V5F96_02865) - 536206..537216 (+) 1011 WP_144998532.1 helix-turn-helix domain-containing protein -
  V5F96_RS02870 (V5F96_02870) - 537231..538013 (+) 783 WP_025456432.1 ATP-binding protein -
  V5F96_RS02875 (V5F96_02875) - 538006..538290 (+) 285 WP_003691437.1 hypothetical protein -
  V5F96_RS02880 (V5F96_02880) - 538329..538823 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  V5F96_RS02885 (V5F96_02885) - 539000..539149 (+) 150 WP_012503493.1 hypothetical protein -
  V5F96_RS02890 (V5F96_02890) - 539178..539459 (+) 282 WP_003689109.1 hypothetical protein -
  V5F96_RS02895 (V5F96_02895) - 539450..539830 (+) 381 WP_232050781.1 RusA family crossover junction endodeoxyribonuclease -
  V5F96_RS02900 (V5F96_02900) - 540097..540504 (+) 408 WP_003691430.1 hypothetical protein -
  V5F96_RS02905 (V5F96_02905) - 540595..541755 (+) 1161 WP_003691428.1 type I restriction endonuclease -
  V5F96_RS02910 (V5F96_02910) - 542037..542906 (+) 870 WP_014580255.1 BRO family protein -
  V5F96_RS02915 (V5F96_02915) - 543199..543648 (+) 450 WP_003695485.1 hypothetical protein -
  V5F96_RS02920 (V5F96_02920) terL 543710..545131 (+) 1422 WP_003697216.1 phage terminase large subunit -
  V5F96_RS02925 (V5F96_02925) - 545128..547275 (+) 2148 WP_003691423.1 phage portal protein -
  V5F96_RS02930 (V5F96_02930) - 547343..548500 (+) 1158 WP_010360058.1 HK97 family phage prohead protease -
  V5F96_RS02935 (V5F96_02935) - 548541..550040 (+) 1500 WP_010951063.1 hypothetical protein -
  V5F96_RS02940 (V5F96_02940) - 550047..550409 (+) 363 WP_003689082.1 hypothetical protein -
  V5F96_RS02945 (V5F96_02945) - 550412..550942 (+) 531 WP_003689080.1 head-tail connector protein -
  V5F96_RS02950 (V5F96_02950) - 550942..551424 (+) 483 WP_010360061.1 HK97 gp10 family phage protein -
  V5F96_RS02955 (V5F96_02955) - 551421..551849 (+) 429 WP_003697213.1 hypothetical protein -
  V5F96_RS02960 (V5F96_02960) - 551875..552648 (+) 774 WP_003691416.1 hypothetical protein -
  V5F96_RS02965 (V5F96_02965) - 552709..553038 (+) 330 WP_003692871.1 hypothetical protein -
  V5F96_RS02970 (V5F96_02970) - 553050..553316 (+) 267 WP_003692873.1 hypothetical protein -
  V5F96_RS02975 (V5F96_02975) - 553316..553915 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  V5F96_RS02980 (V5F96_02980) - 553912..554766 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  V5F96_RS02985 (V5F96_02985) - 554768..555199 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  V5F96_RS02990 (V5F96_02990) - 555227..555505 (-) 279 WP_003689062.1 helix-turn-helix domain-containing protein -
  V5F96_RS02995 (V5F96_02995) - 555745..559890 (+) 4146 WP_014580253.1 phage tail protein -
  V5F96_RS03000 (V5F96_03000) - 560002..560307 (+) 306 WP_003689058.1 hypothetical protein -
  V5F96_RS03005 (V5F96_03005) - 560378..560848 (+) 471 WP_003691410.1 hypothetical protein -
  V5F96_RS03010 (V5F96_03010) - 560849..561181 (+) 333 WP_003691408.1 hypothetical protein -
  V5F96_RS03015 (V5F96_03015) - 561342..561494 (+) 153 WP_014580252.1 hypothetical protein -
  V5F96_RS03020 (V5F96_03020) - 561549..561896 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  V5F96_RS03025 (V5F96_03025) - 561896..562132 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  V5F96_RS03030 (V5F96_03030) - 562172..562297 (+) 126 WP_255294325.1 hypothetical protein -
  V5F96_RS03035 (V5F96_03035) - 562339..562878 (+) 540 WP_050163081.1 TIGR02594 family protein -
  V5F96_RS03040 (V5F96_03040) - 562879..563223 (+) 345 WP_003695464.1 hypothetical protein -
  V5F96_RS03045 (V5F96_03045) - 563207..563380 (+) 174 WP_003705498.1 hypothetical protein -
  V5F96_RS03050 (V5F96_03050) - 563692..563841 (+) 150 WP_003691402.1 hypothetical protein -
  V5F96_RS03055 (V5F96_03055) - 563871..566918 (+) 3048 WP_014580250.1 tape measure protein -
  V5F96_RS03060 (V5F96_03060) - 566978..567457 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  V5F96_RS03065 (V5F96_03065) - 567799..568788 (-) 990 WP_003689040.1 site-specific integrase -
  V5F96_RS03070 (V5F96_03070) - 569048..569236 (-) 189 WP_003689039.1 hypothetical protein -
  V5F96_RS03075 (V5F96_03075) purM 569477..570511 (+) 1035 WP_003691398.1 phosphoribosylformylglycinamidine cyclo-ligase -
  V5F96_RS03080 (V5F96_03080) - 571524..572177 (+) 654 WP_171000408.1 IS1595 family transposase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17506.38 Da        Isoelectric Point: 9.8238

>NTDB_id=936653 V5F96_RS02720 WP_025455782.1 520632..521105(+) (pilL) [Neisseria gonorrhoeae strain WHO_W_2024]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=936653 V5F96_RS02720 WP_025455782.1 520632..521105(+) (pilL) [Neisseria gonorrhoeae strain WHO_W_2024]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG

Domains

Predicted by InterproScan.

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

89.172

100

0.892
  pilX Neisseria meningitidis 8013

85.987

100

0.86