Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   V4U93_RS07170 Genome accession   NZ_CP144755
Coordinates   1410166..1410465 (-) Length   99 a.a.
NCBI ID   WP_025016383.1    Uniprot ID   A0A9N7P7J9
Organism   Latilactobacillus sakei subsp. sakei strain DCF0720     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1405166..1415465
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V4U93_RS07135 (V4U93_07135) - 1405797..1406255 (-) 459 WP_035145008.1 hypothetical protein -
  V4U93_RS07140 (V4U93_07140) - 1406310..1407506 (-) 1197 WP_011374993.1 acetate kinase -
  V4U93_RS07145 (V4U93_07145) - 1407528..1408538 (-) 1011 WP_338453560.1 class I SAM-dependent methyltransferase -
  V4U93_RS07150 (V4U93_07150) - 1408662..1409000 (-) 339 WP_035145011.1 hypothetical protein -
  V4U93_RS07155 (V4U93_07155) comGF 1408963..1409475 (-) 513 WP_035145013.1 competence type IV pilus minor pilin ComGF Machinery gene
  V4U93_RS07160 (V4U93_07160) comGE 1409450..1409755 (-) 306 WP_016265375.1 hypothetical protein Machinery gene
  V4U93_RS07165 (V4U93_07165) comGD 1409742..1410194 (-) 453 WP_105300046.1 competence type IV pilus minor pilin ComGD Machinery gene
  V4U93_RS07170 (V4U93_07170) comGC 1410166..1410465 (-) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  V4U93_RS07175 (V4U93_07175) comGB 1410462..1411469 (-) 1008 WP_061827023.1 type II secretion system F family protein Machinery gene
  V4U93_RS07180 (V4U93_07180) comGA 1411462..1412352 (-) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  V4U93_RS07185 (V4U93_07185) - 1412469..1413200 (-) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  V4U93_RS07190 (V4U93_07190) - 1413291..1413791 (-) 501 WP_016265379.1 VanZ family protein -
  V4U93_RS07195 (V4U93_07195) - 1413888..1414262 (+) 375 WP_011375004.1 hypothetical protein -
  V4U93_RS07205 (V4U93_07205) - 1414449..1415063 (-) 615 WP_016265380.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11067.03 Da        Isoelectric Point: 10.1321

>NTDB_id=934732 V4U93_RS07170 WP_025016383.1 1410166..1410465(-) (comGC) [Latilactobacillus sakei subsp. sakei strain DCF0720]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKKTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKEKGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=934732 V4U93_RS07170 WP_025016383.1 1410166..1410465(-) (comGC) [Latilactobacillus sakei subsp. sakei strain DCF0720]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCAATTGTGGCATTGTTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAAAACCGATCAAGCTTTAGTGACGACTTTACAAACGCAAG
TTGAATTGGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGATGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGATAGCGGCACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

89.899

100

0.899