Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   V3829_RS01400 Genome accession   NZ_CP144358
Coordinates   299530..299907 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain DJ4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 294530..304907
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3829_RS01360 - 295029..295823 (+) 795 WP_014305407.1 YqhG family protein -
  V3829_RS01365 sinI 296000..296173 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  V3829_RS01370 sinR 296207..296542 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V3829_RS01375 tasA 296590..297375 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  V3829_RS01380 sipW 297439..298023 (-) 585 WP_046559873.1 signal peptidase I SipW -
  V3829_RS01385 tapA 297995..298666 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  V3829_RS01390 - 298925..299254 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  V3829_RS01395 - 299294..299473 (-) 180 WP_003153093.1 YqzE family protein -
  V3829_RS01400 comGG 299530..299907 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  V3829_RS01405 comGF 299908..300303 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  V3829_RS01410 comGE 300317..300631 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  V3829_RS01415 comGD 300615..301052 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  V3829_RS01420 comGC 301042..301308 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  V3829_RS01425 comGB 301355..302392 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  V3829_RS01430 comGA 302379..303449 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  V3829_RS01435 - 303641..304591 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=933694 V3829_RS01400 WP_014305410.1 299530..299907(-) (comGG) [Bacillus velezensis strain DJ4]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=933694 V3829_RS01400 WP_014305410.1 299530..299907(-) (comGG) [Bacillus velezensis strain DJ4]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTATTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTTGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512