Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   V3829_RS01365 Genome accession   NZ_CP144358
Coordinates   296000..296173 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain DJ4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 291000..301173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3829_RS01350 gcvT 291818..292918 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  V3829_RS01355 - 293341..295011 (+) 1671 WP_046559872.1 DEAD/DEAH box helicase -
  V3829_RS01360 - 295029..295823 (+) 795 WP_014305407.1 YqhG family protein -
  V3829_RS01365 sinI 296000..296173 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  V3829_RS01370 sinR 296207..296542 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V3829_RS01375 tasA 296590..297375 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  V3829_RS01380 sipW 297439..298023 (-) 585 WP_046559873.1 signal peptidase I SipW -
  V3829_RS01385 tapA 297995..298666 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  V3829_RS01390 - 298925..299254 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  V3829_RS01395 - 299294..299473 (-) 180 WP_003153093.1 YqzE family protein -
  V3829_RS01400 comGG 299530..299907 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  V3829_RS01405 comGF 299908..300303 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  V3829_RS01410 comGE 300317..300631 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  V3829_RS01415 comGD 300615..301052 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=933692 V3829_RS01365 WP_003153105.1 296000..296173(+) (sinI) [Bacillus velezensis strain DJ4]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=933692 V3829_RS01365 WP_003153105.1 296000..296173(+) (sinI) [Bacillus velezensis strain DJ4]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702