Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   U6C02_RS03285 Genome accession   NZ_CP143843
Coordinates   616974..617093 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain YM-3     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 611974..622093
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U6C02_RS03260 (U6C02_03260) - 612213..612971 (-) 759 WP_022552588.1 ABC transporter ATP-binding protein -
  U6C02_RS03265 (U6C02_03265) - 612965..613912 (-) 948 WP_069448545.1 iron chelate uptake ABC transporter family permease subunit -
  U6C02_RS03270 (U6C02_03270) ceuB 613902..614855 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  U6C02_RS03275 (U6C02_03275) - 615270..616634 (+) 1365 WP_003156333.1 aspartate kinase -
  U6C02_RS03280 (U6C02_03280) - 616714..616824 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  U6C02_RS03285 (U6C02_03285) phrC 616974..617093 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  U6C02_RS03290 (U6C02_03290) rapC 617077..618225 (-) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  U6C02_RS03295 (U6C02_03295) - 618378..619811 (-) 1434 WP_162130794.1 sensor histidine kinase -
  U6C02_RS03300 (U6C02_03300) - 619798..620481 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=931484 U6C02_RS03285 WP_003156334.1 616974..617093(-) (phrC) [Bacillus velezensis strain YM-3]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=931484 U6C02_RS03285 WP_003156334.1 616974..617093(-) (phrC) [Bacillus velezensis strain YM-3]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718