NTDB

Overview

Name	comGF	Type	Machinery gene
Locus tag	sa230627_RS07475	Genome accession	NZ_CP143800
Coordinates	1554816..1555313 (-)	Length	165 a.a.
NCBI ID	WP_029694050.1	Uniprot ID	-
Organism	Staphylococcus aureus strain sa230627barcode06
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1549816..1560313

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
sa230627_RS07450 (sa230627_1431)	gcvPB	1549978..1551450 (-)	1473	WP_000202188.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPB	-
sa230627_RS07455 (sa230627_1432)	gcvPA	1551443..1552789 (-)	1347	WP_000019691.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
sa230627_RS07460 (sa230627_1433)	gcvT	1552809..1553900 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
sa230627_RS07465 (sa230627_1434)	-	1554059..1554583 (-)	525	WP_001015121.1	shikimate kinase	-
sa230627_RS07470	-	1554573..1554719 (-)	147	WP_001789879.1	hypothetical protein	-
sa230627_RS07475 (sa230627_1435)	comGF	1554816..1555313 (-)	498	WP_029694050.1	competence type IV pilus minor pilin ComGF	Machinery gene
sa230627_RS07480 (sa230627_1436)	comGE	1555231..1555530 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
sa230627_RS07485 (sa230627_1437)	comGD	1555517..1555963 (-)	447	WP_072433556.1	competence type IV pilus minor pilin ComGD	Machinery gene
sa230627_RS07490 (sa230627_1438)	comGC	1555941..1556252 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
sa230627_RS07495 (sa230627_1439)	comGB	1556266..1557336 (-)	1071	WP_000776421.1	competence type IV pilus assembly protein ComGB	Machinery gene
sa230627_RS07500 (sa230627_1440)	comGA	1557308..1558282 (-)	975	Protein_1471	competence type IV pilus ATPase ComGA	-
sa230627_RS07505 (sa230627_1442)	-	1558334..1558957 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
sa230627_RS07510 (sa230627_1443)	-	1558954..1559283 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
sa230627_RS07515 (sa230627_1444)	-	1559283..1560269 (-)	987	WP_000161314.1	ROK family glucokinase	-

Sequence

Protein

Download Length: 165 a.a. Molecular weight: 19199.92 Da Isoelectric Point: 10.2192

                                >NTDB_id=931456 sa230627_RS07475 WP_029694050.1 1554816..1555313(-) (comGF) [Staphylococcus aureus strain sa230627barcode06]

MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKTFLIESRELTTVDFEFFSRDI

LEDFKGVDRNDIELRQQRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTSFTANIYYKSIIKITITVKVGTNVQT

KTIYV

Nucleotide

Download Length: 498 bp

                                >NTDB_id=931456 sa230627_RS07475 WP_029694050.1 1554816..1555313(-) (comGF) [Staphylococcus aureus strain sa230627barcode06]

ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTAT

TAATGTCAAAGCTTTTTCGCTCATTGAAATGTTAGTAGCGATGATGGTTATAAGTATAACTTTACTAATTGTTCCAGACT

TAATTAGACTTAGCAAAACTTTTCTAATTGAAAGTAGGGAATTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT

CTAGAGGATTTTAAAGGAGTAGATAGAAACGATATTGAACTTAGGCAACAGCGTATCATTTTACATAAAGGTGAAGAAAT

GATCGAATACAAATTAATAAATAATAAAATTATTAAAGTTGTAAATGACAGAGGAAATATAACAATGATTAATAATGTTA

CTTCATTTACTGCAAATATCTACTATAAATCCATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATGTGCAGACT

AAAACTATTTATGTATAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(68-155)

Prokaryotic N-terminal methylation motif (N_methyl)

(28-51)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGF	Staphylococcus aureus MW2	96.97	100	0.97
comGF	Staphylococcus aureus N315	96.97	100	0.97

Detailed information NTG0931456