Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   V2I11_RS11735 Genome accession   NZ_CP143783
Coordinates   2445650..2446087 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain JSZ06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2440650..2451087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V2I11_RS11685 sinI 2441033..2441206 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  V2I11_RS11690 sinR 2441240..2441575 (+) 336 WP_330728946.1 transcriptional regulator SinR Regulator
  V2I11_RS11695 tasA 2441623..2442408 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  V2I11_RS11700 sipW 2442473..2443057 (-) 585 WP_032874025.1 signal peptidase I SipW -
  V2I11_RS11705 tapA 2443029..2443700 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  V2I11_RS11710 - 2443959..2444288 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  V2I11_RS11715 - 2444329..2444508 (-) 180 WP_022552966.1 YqzE family protein -
  V2I11_RS11720 comGG 2444565..2444942 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  V2I11_RS11725 comGF 2444943..2445443 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  V2I11_RS11730 comGE 2445352..2445666 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  V2I11_RS11735 comGD 2445650..2446087 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  V2I11_RS11740 comGC 2446077..2446385 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V2I11_RS11745 comGB 2446390..2447427 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  V2I11_RS11750 comGA 2447414..2448484 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  V2I11_RS11755 - 2448681..2449631 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  V2I11_RS11760 - 2449777..2451078 (+) 1302 WP_032874010.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=931406 V2I11_RS11735 WP_007612572.1 2445650..2446087(-) (comGD) [Bacillus velezensis strain JSZ06]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=931406 V2I11_RS11735 WP_007612572.1 2445650..2446087(-) (comGD) [Bacillus velezensis strain JSZ06]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559