Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   V2I11_RS11685 Genome accession   NZ_CP143783
Coordinates   2441033..2441206 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain JSZ06     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2436033..2446206
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V2I11_RS11670 gcvT 2436847..2437947 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  V2I11_RS11675 - 2438370..2440040 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  V2I11_RS11680 - 2440062..2440856 (+) 795 WP_007612541.1 YqhG family protein -
  V2I11_RS11685 sinI 2441033..2441206 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  V2I11_RS11690 sinR 2441240..2441575 (+) 336 WP_330728946.1 transcriptional regulator SinR Regulator
  V2I11_RS11695 tasA 2441623..2442408 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  V2I11_RS11700 sipW 2442473..2443057 (-) 585 WP_032874025.1 signal peptidase I SipW -
  V2I11_RS11705 tapA 2443029..2443700 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  V2I11_RS11710 - 2443959..2444288 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  V2I11_RS11715 - 2444329..2444508 (-) 180 WP_022552966.1 YqzE family protein -
  V2I11_RS11720 comGG 2444565..2444942 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  V2I11_RS11725 comGF 2444943..2445443 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  V2I11_RS11730 comGE 2445352..2445666 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  V2I11_RS11735 comGD 2445650..2446087 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=931402 V2I11_RS11685 WP_032874029.1 2441033..2441206(+) (sinI) [Bacillus velezensis strain JSZ06]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=931402 V2I11_RS11685 WP_032874029.1 2441033..2441206(+) (sinI) [Bacillus velezensis strain JSZ06]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719