Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   VP456_RS16630 Genome accession   NZ_CP142142
Coordinates   3278220..3278360 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain PD9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3273220..3283360
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VP456_RS16605 (VP456_16545) - 3273560..3273943 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  VP456_RS16610 (VP456_16550) comA 3273965..3274609 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  VP456_RS16615 (VP456_16555) comP 3274690..3276981 (-) 2292 WP_099721970.1 histidine kinase Regulator
  VP456_RS16620 (VP456_16560) comX 3276993..3277157 (-) 165 WP_007613432.1 competence pheromone ComX -
  VP456_RS16625 (VP456_16565) - 3277157..3278068 (-) 912 WP_022553710.1 polyprenyl synthetase family protein -
  VP456_RS16630 (VP456_16570) degQ 3278220..3278360 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  VP456_RS16635 (VP456_16575) - 3278826..3279167 (+) 342 WP_014418765.1 hypothetical protein -
  VP456_RS16640 (VP456_16580) - 3279174..3280397 (-) 1224 WP_029973798.1 EAL and HDOD domain-containing protein -
  VP456_RS16645 (VP456_16585) - 3280527..3281993 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  VP456_RS16650 (VP456_16590) - 3282011..3282562 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  VP456_RS16655 (VP456_16595) - 3282659..3283057 (-) 399 WP_029973800.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=921948 VP456_RS16630 WP_003152043.1 3278220..3278360(-) (degQ) [Bacillus velezensis strain PD9]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=921948 VP456_RS16630 WP_003152043.1 3278220..3278360(-) (degQ) [Bacillus velezensis strain PD9]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891