Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   VP456_RS13560 Genome accession   NZ_CP142142
Coordinates   2703034..2703348 (-) Length   104 a.a.
NCBI ID   WP_029973875.1    Uniprot ID   -
Organism   Bacillus velezensis strain PD9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2698034..2708348
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VP456_RS13515 (VP456_13480) sinI 2698715..2698888 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  VP456_RS13520 (VP456_13485) sinR 2698922..2699257 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VP456_RS13525 (VP456_13490) tasA 2699305..2700090 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  VP456_RS13530 (VP456_13495) sipW 2700155..2700739 (-) 585 WP_012117977.1 signal peptidase I SipW -
  VP456_RS13535 (VP456_13500) tapA 2700711..2701382 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  VP456_RS13540 (VP456_13505) - 2701641..2701970 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VP456_RS13545 (VP456_13510) - 2702011..2702190 (-) 180 WP_003153093.1 YqzE family protein -
  VP456_RS13550 (VP456_13515) comGG 2702247..2702624 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  VP456_RS13555 (VP456_13520) comGF 2702625..2703089 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  VP456_RS13560 (VP456_13525) comGE 2703034..2703348 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  VP456_RS13565 (VP456_13530) comGD 2703332..2703769 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  VP456_RS13570 (VP456_13535) comGC 2703759..2704067 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  VP456_RS13575 (VP456_13540) comGB 2704072..2705109 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  VP456_RS13580 (VP456_13545) comGA 2705096..2706166 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  VP456_RS13585 (VP456_13550) - 2706359..2707309 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11862.88 Da        Isoelectric Point: 6.9470

>NTDB_id=921929 VP456_RS13560 WP_029973875.1 2703034..2703348(-) (comGE) [Bacillus velezensis strain PD9]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=921929 VP456_RS13560 WP_029973875.1 2703034..2703348(-) (comGE) [Bacillus velezensis strain PD9]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49