Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VP456_RS13515 Genome accession   NZ_CP142142
Coordinates   2698715..2698888 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain PD9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2693715..2703888
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VP456_RS13500 (VP456_13465) gcvT 2694528..2695628 (-) 1101 WP_029973877.1 glycine cleavage system aminomethyltransferase GcvT -
  VP456_RS13505 (VP456_13470) - 2696052..2697722 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  VP456_RS13510 (VP456_13475) - 2697744..2698538 (+) 795 WP_014418368.1 YqhG family protein -
  VP456_RS13515 (VP456_13480) sinI 2698715..2698888 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  VP456_RS13520 (VP456_13485) sinR 2698922..2699257 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VP456_RS13525 (VP456_13490) tasA 2699305..2700090 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  VP456_RS13530 (VP456_13495) sipW 2700155..2700739 (-) 585 WP_012117977.1 signal peptidase I SipW -
  VP456_RS13535 (VP456_13500) tapA 2700711..2701382 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  VP456_RS13540 (VP456_13505) - 2701641..2701970 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VP456_RS13545 (VP456_13510) - 2702011..2702190 (-) 180 WP_003153093.1 YqzE family protein -
  VP456_RS13550 (VP456_13515) comGG 2702247..2702624 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  VP456_RS13555 (VP456_13520) comGF 2702625..2703089 (-) 465 WP_233717055.1 competence type IV pilus minor pilin ComGF -
  VP456_RS13560 (VP456_13525) comGE 2703034..2703348 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  VP456_RS13565 (VP456_13530) comGD 2703332..2703769 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=921926 VP456_RS13515 WP_014418369.1 2698715..2698888(+) (sinI) [Bacillus velezensis strain PD9]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=921926 VP456_RS13515 WP_014418369.1 2698715..2698888(+) (sinI) [Bacillus velezensis strain PD9]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719