Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   VO179_RS08275 Genome accession   NZ_CP141827
Coordinates   1768561..1768701 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain XHA14     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1763561..1773701
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO179_RS08250 (VO179_08250) - 1763888..1764271 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  VO179_RS08255 (VO179_08255) comA 1764293..1764937 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  VO179_RS08260 (VO179_08260) comP 1765018..1767324 (-) 2307 WP_324636435.1 sensor histidine kinase Regulator
  VO179_RS08265 (VO179_08265) comX 1767343..1767519 (-) 177 WP_015240484.1 competence pheromone ComX -
  VO179_RS08270 (VO179_08270) - 1767534..1768409 (-) 876 WP_122504180.1 polyprenyl synthetase family protein -
  VO179_RS08275 (VO179_08275) degQ 1768561..1768701 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  VO179_RS08280 (VO179_08280) - 1769164..1769505 (+) 342 WP_007408677.1 hypothetical protein -
  VO179_RS08285 (VO179_08285) - 1769512..1770735 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  VO179_RS08290 (VO179_08290) - 1770865..1772331 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  VO179_RS08295 (VO179_08295) - 1772349..1772900 (-) 552 WP_324636434.1 cysteine hydrolase family protein -
  VO179_RS08300 (VO179_08300) - 1772997..1773395 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=919890 VO179_RS08275 WP_003152043.1 1768561..1768701(-) (degQ) [Bacillus velezensis strain XHA14]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=919890 VO179_RS08275 WP_003152043.1 1768561..1768701(-) (degQ) [Bacillus velezensis strain XHA14]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891