Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   VO179_RS05240 Genome accession   NZ_CP141827
Coordinates   1196003..1196269 (-) Length   88 a.a.
NCBI ID   WP_050515801.1    Uniprot ID   -
Organism   Bacillus velezensis strain XHA14     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1191003..1201269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO179_RS05190 (VO179_05190) sinR 1191167..1191502 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VO179_RS05195 (VO179_05195) tasA 1191550..1192335 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  VO179_RS05200 (VO179_05200) sipW 1192400..1192984 (-) 585 WP_015240205.1 signal peptidase I SipW -
  VO179_RS05205 (VO179_05205) tapA 1192956..1193627 (-) 672 WP_324636720.1 amyloid fiber anchoring/assembly protein TapA -
  VO179_RS05210 (VO179_05210) - 1193886..1194215 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VO179_RS05215 (VO179_05215) - 1194255..1194434 (-) 180 WP_003153093.1 YqzE family protein -
  VO179_RS05220 (VO179_05220) comGG 1194491..1194868 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  VO179_RS05225 (VO179_05225) comGF 1194869..1195264 (-) 396 WP_324636718.1 competence type IV pilus minor pilin ComGF -
  VO179_RS05230 (VO179_05230) comGE 1195278..1195592 (-) 315 WP_324636717.1 competence type IV pilus minor pilin ComGE -
  VO179_RS05235 (VO179_05235) comGD 1195576..1196013 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  VO179_RS05240 (VO179_05240) comGC 1196003..1196269 (-) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  VO179_RS05245 (VO179_05245) comGB 1196316..1197353 (-) 1038 WP_154817564.1 competence type IV pilus assembly protein ComGB Machinery gene
  VO179_RS05250 (VO179_05250) comGA 1197340..1198410 (-) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  VO179_RS05255 (VO179_05255) - 1198603..1199553 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  VO179_RS05260 (VO179_05260) - 1199699..1201000 (+) 1302 WP_324636716.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9749.37 Da        Isoelectric Point: 6.2027

>NTDB_id=919873 VO179_RS05240 WP_050515801.1 1196003..1196269(-) (comGC) [Bacillus velezensis strain XHA14]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTVCPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=919873 VO179_RS05240 WP_050515801.1 1196003..1196269(-) (comGC) [Bacillus velezensis strain XHA14]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGTCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

76.056

80.682

0.614