Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VO180_RS07890 Genome accession   NZ_CP141826
Coordinates   1547235..1547408 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain XHA16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1542235..1552408
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO180_RS07840 (VO180_07840) comGD 1542355..1542792 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  VO180_RS07845 (VO180_07845) comGE 1542776..1543090 (+) 315 WP_324636717.1 competence type IV pilus minor pilin ComGE -
  VO180_RS07850 (VO180_07850) comGF 1543104..1543499 (+) 396 WP_324636718.1 competence type IV pilus minor pilin ComGF -
  VO180_RS07855 (VO180_07855) comGG 1543500..1543877 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  VO180_RS07860 (VO180_07860) - 1543934..1544113 (+) 180 WP_003153093.1 YqzE family protein -
  VO180_RS07865 (VO180_07865) - 1544153..1544482 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VO180_RS07870 (VO180_07870) tapA 1544741..1545412 (+) 672 WP_324636720.1 amyloid fiber anchoring/assembly protein TapA -
  VO180_RS07875 (VO180_07875) sipW 1545384..1545968 (+) 585 WP_015240205.1 signal peptidase I SipW -
  VO180_RS07880 (VO180_07880) tasA 1546033..1546818 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  VO180_RS07885 (VO180_07885) sinR 1546866..1547201 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VO180_RS07890 (VO180_07890) sinI 1547235..1547408 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  VO180_RS07895 (VO180_07895) - 1547585..1548379 (-) 795 WP_156240427.1 YqhG family protein -
  VO180_RS07900 (VO180_07900) - 1548401..1550071 (-) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  VO180_RS07905 (VO180_07905) gcvT 1550495..1551595 (+) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=919818 VO180_RS07890 WP_003153105.1 1547235..1547408(-) (sinI) [Bacillus velezensis strain XHA16]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=919818 VO180_RS07890 WP_003153105.1 1547235..1547408(-) (sinI) [Bacillus velezensis strain XHA16]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702