Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   VO180_RS07855 Genome accession   NZ_CP141826
Coordinates   1543500..1543877 (+) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain XHA16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1538500..1548877
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO180_RS07820 (VO180_07820) - 1538815..1539765 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  VO180_RS07825 (VO180_07825) comGA 1539958..1541028 (+) 1071 WP_007408320.1 competence type IV pilus ATPase ComGA Machinery gene
  VO180_RS07830 (VO180_07830) comGB 1541015..1542052 (+) 1038 WP_154817564.1 competence type IV pilus assembly protein ComGB Machinery gene
  VO180_RS07835 (VO180_07835) comGC 1542057..1542365 (+) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  VO180_RS07840 (VO180_07840) comGD 1542355..1542792 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  VO180_RS07845 (VO180_07845) comGE 1542776..1543090 (+) 315 WP_324636717.1 competence type IV pilus minor pilin ComGE -
  VO180_RS07850 (VO180_07850) comGF 1543104..1543499 (+) 396 WP_324636718.1 competence type IV pilus minor pilin ComGF -
  VO180_RS07855 (VO180_07855) comGG 1543500..1543877 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  VO180_RS07860 (VO180_07860) - 1543934..1544113 (+) 180 WP_003153093.1 YqzE family protein -
  VO180_RS07865 (VO180_07865) - 1544153..1544482 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  VO180_RS07870 (VO180_07870) tapA 1544741..1545412 (+) 672 WP_324636720.1 amyloid fiber anchoring/assembly protein TapA -
  VO180_RS07875 (VO180_07875) sipW 1545384..1545968 (+) 585 WP_015240205.1 signal peptidase I SipW -
  VO180_RS07880 (VO180_07880) tasA 1546033..1546818 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  VO180_RS07885 (VO180_07885) sinR 1546866..1547201 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VO180_RS07890 (VO180_07890) sinI 1547235..1547408 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  VO180_RS07895 (VO180_07895) - 1547585..1548379 (-) 795 WP_156240427.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=919816 VO180_RS07855 WP_015417814.1 1543500..1543877(+) (comGG) [Bacillus velezensis strain XHA16]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=919816 VO180_RS07855 WP_015417814.1 1543500..1543877(+) (comGG) [Bacillus velezensis strain XHA16]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
CTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504