Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   VO180_RS04800 Genome accession   NZ_CP141826
Coordinates   969667..969807 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain XHA16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 964667..974807
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO180_RS04775 (VO180_04775) - 964973..965371 (+) 399 WP_003152031.1 YueI family protein -
  VO180_RS04780 (VO180_04780) - 965468..966019 (+) 552 WP_324636434.1 cysteine hydrolase family protein -
  VO180_RS04785 (VO180_04785) - 966037..967503 (+) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  VO180_RS04790 (VO180_04790) - 967633..968856 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  VO180_RS04795 (VO180_04795) - 968863..969204 (-) 342 WP_007408677.1 hypothetical protein -
  VO180_RS04800 (VO180_04800) degQ 969667..969807 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  VO180_RS04805 (VO180_04805) - 969959..970834 (+) 876 WP_122504180.1 polyprenyl synthetase family protein -
  VO180_RS04810 (VO180_04810) comX 970849..971025 (+) 177 WP_015240484.1 competence pheromone ComX -
  VO180_RS04815 (VO180_04815) comP 971044..973350 (+) 2307 WP_324636435.1 sensor histidine kinase Regulator
  VO180_RS04820 (VO180_04820) comA 973431..974075 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  VO180_RS04825 (VO180_04825) - 974097..974480 (+) 384 WP_014418761.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=919797 VO180_RS04800 WP_003152043.1 969667..969807(+) (degQ) [Bacillus velezensis strain XHA16]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=919797 VO180_RS04800 WP_003152043.1 969667..969807(+) (degQ) [Bacillus velezensis strain XHA16]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891