Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   U2H22_RS13160 Genome accession   NZ_CP141265
Coordinates   2637500..2637877 (-) Length   125 a.a.
NCBI ID   WP_015240208.1    Uniprot ID   -
Organism   Bacillus velezensis strain L2D39     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2632500..2642877
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U2H22_RS13120 (U2H22_13120) - 2632998..2633792 (+) 795 WP_208480294.1 YqhG family protein -
  U2H22_RS13125 (U2H22_13125) sinI 2633969..2634142 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  U2H22_RS13130 (U2H22_13130) sinR 2634176..2634511 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U2H22_RS13135 (U2H22_13135) - 2634559..2635344 (-) 786 WP_007408329.1 TasA family protein -
  U2H22_RS13140 (U2H22_13140) - 2635409..2635993 (-) 585 WP_015240205.1 signal peptidase I -
  U2H22_RS13145 (U2H22_13145) tapA 2635965..2636636 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  U2H22_RS13150 (U2H22_13150) - 2636895..2637224 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  U2H22_RS13155 (U2H22_13155) - 2637264..2637443 (-) 180 WP_003153093.1 YqzE family protein -
  U2H22_RS13160 (U2H22_13160) comGG 2637500..2637877 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  U2H22_RS13165 (U2H22_13165) comGF 2637878..2638378 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  U2H22_RS13170 (U2H22_13170) comGE 2638287..2638601 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  U2H22_RS13175 (U2H22_13175) comGD 2638585..2639022 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene
  U2H22_RS13180 (U2H22_13180) comGC 2639012..2639320 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  U2H22_RS13185 (U2H22_13185) comGB 2639325..2640362 (-) 1038 WP_218791295.1 competence type IV pilus assembly protein ComGB Machinery gene
  U2H22_RS13190 (U2H22_13190) comGA 2640349..2641419 (-) 1071 WP_124692840.1 competence type IV pilus ATPase ComGA Machinery gene
  U2H22_RS13195 (U2H22_13195) - 2641612..2642562 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14123.08 Da        Isoelectric Point: 9.9599

>NTDB_id=916667 U2H22_RS13160 WP_015240208.1 2637500..2637877(-) (comGG) [Bacillus velezensis strain L2D39]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRRGAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=916667 U2H22_RS13160 WP_015240208.1 2637500..2637877(-) (comGG) [Bacillus velezensis strain L2D39]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGG
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512