Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   U2H22_RS13125 Genome accession   NZ_CP141265
Coordinates   2633969..2634142 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain L2D39     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2628969..2639142
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U2H22_RS13110 (U2H22_13110) gcvT 2629782..2630882 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  U2H22_RS13115 (U2H22_13115) - 2631306..2632976 (+) 1671 WP_132105375.1 SNF2-related protein -
  U2H22_RS13120 (U2H22_13120) - 2632998..2633792 (+) 795 WP_208480294.1 YqhG family protein -
  U2H22_RS13125 (U2H22_13125) sinI 2633969..2634142 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  U2H22_RS13130 (U2H22_13130) sinR 2634176..2634511 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U2H22_RS13135 (U2H22_13135) - 2634559..2635344 (-) 786 WP_007408329.1 TasA family protein -
  U2H22_RS13140 (U2H22_13140) - 2635409..2635993 (-) 585 WP_015240205.1 signal peptidase I -
  U2H22_RS13145 (U2H22_13145) tapA 2635965..2636636 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  U2H22_RS13150 (U2H22_13150) - 2636895..2637224 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  U2H22_RS13155 (U2H22_13155) - 2637264..2637443 (-) 180 WP_003153093.1 YqzE family protein -
  U2H22_RS13160 (U2H22_13160) comGG 2637500..2637877 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  U2H22_RS13165 (U2H22_13165) comGF 2637878..2638378 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  U2H22_RS13170 (U2H22_13170) comGE 2638287..2638601 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  U2H22_RS13175 (U2H22_13175) comGD 2638585..2639022 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=916665 U2H22_RS13125 WP_003153105.1 2633969..2634142(+) (sinI) [Bacillus velezensis strain L2D39]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=916665 U2H22_RS13125 WP_003153105.1 2633969..2634142(+) (sinI) [Bacillus velezensis strain L2D39]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702