Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   U6I89_RS16540 Genome accession   NZ_CP141263
Coordinates   3242343..3242483 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain BIM B-2002     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3237343..3247483
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U6I89_RS16515 (U6I89_16515) - 3237693..3238073 (-) 381 WP_019259331.1 hotdog fold thioesterase -
  U6I89_RS16520 (U6I89_16520) comA 3238092..3238736 (-) 645 WP_104010190.1 two-component system response regulator ComA Regulator
  U6I89_RS16525 (U6I89_16525) comP 3238817..3241114 (-) 2298 WP_060399389.1 histidine kinase Regulator
  U6I89_RS16530 (U6I89_16530) comX 3241122..3241283 (-) 162 WP_003241045.1 competence pheromone ComX -
  U6I89_RS16535 (U6I89_16535) - 3241298..3242158 (-) 861 WP_032732270.1 polyprenyl synthetase family protein -
  U6I89_RS16540 (U6I89_16540) degQ 3242343..3242483 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  U6I89_RS16545 (U6I89_16545) - 3242663..3242830 (+) 168 WP_119914210.1 hypothetical protein -
  U6I89_RS16550 (U6I89_16550) - 3242943..3243311 (+) 369 WP_003241042.1 hypothetical protein -
  U6I89_RS16555 (U6I89_16555) pdeH 3243287..3244516 (-) 1230 WP_060399390.1 cyclic di-GMP phosphodiesterase -
  U6I89_RS16560 (U6I89_16560) - 3244654..3246126 (-) 1473 WP_060399391.1 nicotinate phosphoribosyltransferase -
  U6I89_RS16565 (U6I89_16565) - 3246142..3246693 (-) 552 WP_060399392.1 cysteine hydrolase family protein -
  U6I89_RS16570 (U6I89_16570) - 3246790..3247188 (-) 399 WP_019259337.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=916578 U6I89_RS16540 WP_003220708.1 3242343..3242483(-) (degQ) [Bacillus inaquosorum strain BIM B-2002]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=916578 U6I89_RS16540 WP_003220708.1 3242343..3242483(-) (degQ) [Bacillus inaquosorum strain BIM B-2002]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACAACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1