Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   U2H13_RS12170 Genome accession   NZ_CP141181
Coordinates   2512384..2512698 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus sp. A1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2507384..2517698
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U2H13_RS12125 (U2H13_12110) sinI 2508065..2508238 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  U2H13_RS12130 (U2H13_12115) sinR 2508272..2508607 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U2H13_RS12135 (U2H13_12120) tasA 2508655..2509440 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  U2H13_RS12140 (U2H13_12125) sipW 2509505..2510089 (-) 585 WP_012117977.1 signal peptidase I SipW -
  U2H13_RS12145 (U2H13_12130) tapA 2510061..2510732 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  U2H13_RS12150 (U2H13_12135) - 2510991..2511320 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  U2H13_RS12155 (U2H13_12140) - 2511361..2511540 (-) 180 WP_003153093.1 YqzE family protein -
  U2H13_RS12160 (U2H13_12145) comGG 2511597..2511974 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  U2H13_RS12165 (U2H13_12150) comGF 2511975..2512370 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  U2H13_RS12170 (U2H13_12155) comGE 2512384..2512698 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  U2H13_RS12175 (U2H13_12160) comGD 2512682..2513119 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  U2H13_RS12180 (U2H13_12165) comGC 2513109..2513417 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  U2H13_RS12185 (U2H13_12170) comGB 2513422..2514459 (-) 1038 WP_088461121.1 competence type IV pilus assembly protein ComGB Machinery gene
  U2H13_RS12190 (U2H13_12175) comGA 2514446..2515516 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  U2H13_RS12195 (U2H13_12180) - 2515709..2516659 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=916253 U2H13_RS12170 WP_017418140.1 2512384..2512698(-) (comGE) [Bacillus sp. A1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=916253 U2H13_RS12170 WP_017418140.1 2512384..2512698(-) (comGE) [Bacillus sp. A1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481