Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   U2H13_RS12125 Genome accession   NZ_CP141181
Coordinates   2508065..2508238 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus sp. A1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2503065..2513238
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U2H13_RS12110 (U2H13_12095) gcvT 2503878..2504978 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  U2H13_RS12115 (U2H13_12100) - 2505402..2507072 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  U2H13_RS12120 (U2H13_12105) - 2507094..2507888 (+) 795 WP_014418368.1 YqhG family protein -
  U2H13_RS12125 (U2H13_12110) sinI 2508065..2508238 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  U2H13_RS12130 (U2H13_12115) sinR 2508272..2508607 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U2H13_RS12135 (U2H13_12120) tasA 2508655..2509440 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  U2H13_RS12140 (U2H13_12125) sipW 2509505..2510089 (-) 585 WP_012117977.1 signal peptidase I SipW -
  U2H13_RS12145 (U2H13_12130) tapA 2510061..2510732 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  U2H13_RS12150 (U2H13_12135) - 2510991..2511320 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  U2H13_RS12155 (U2H13_12140) - 2511361..2511540 (-) 180 WP_003153093.1 YqzE family protein -
  U2H13_RS12160 (U2H13_12145) comGG 2511597..2511974 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  U2H13_RS12165 (U2H13_12150) comGF 2511975..2512370 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  U2H13_RS12170 (U2H13_12155) comGE 2512384..2512698 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  U2H13_RS12175 (U2H13_12160) comGD 2512682..2513119 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=916250 U2H13_RS12125 WP_014418369.1 2508065..2508238(+) (sinI) [Bacillus sp. A1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=916250 U2H13_RS12125 WP_014418369.1 2508065..2508238(+) (sinI) [Bacillus sp. A1]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719