Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   L6430_RS20245 Genome accession   NZ_AP025342
Coordinates   4035425..4035601 (+) Length   58 a.a.
NCBI ID   WP_020452165.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain J41TS8     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 4030425..4040601
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6430_RS20230 gcvT 4031065..4032159 (-) 1095 WP_020452162.1 glycine cleavage system aminomethyltransferase GcvT -
  L6430_RS20235 - 4032754..4034433 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  L6430_RS20240 - 4034440..4035234 (+) 795 WP_020452164.1 YqhG family protein -
  L6430_RS20245 sinI 4035425..4035601 (+) 177 WP_020452165.1 anti-repressor SinI Regulator
  L6430_RS20250 sinR 4035635..4035970 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  L6430_RS20255 tasA 4036075..4036869 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  L6430_RS20260 sipW 4036942..4037526 (-) 585 WP_065644169.1 signal peptidase I SipW -
  L6430_RS20265 tapA 4037523..4038251 (-) 729 WP_020452169.1 amyloid fiber anchoring/assembly protein TapA -
  L6430_RS20270 - 4038529..4038849 (+) 321 WP_020452170.1 YqzG/YhdC family protein -
  L6430_RS20275 - 4038879..4039061 (-) 183 WP_020452171.1 YqzE family protein -
  L6430_RS20280 comGG 4039150..4039515 (-) 366 WP_020452172.1 competence type IV pilus minor pilin ComGG -
  L6430_RS20285 comGF 4039527..4040015 (-) 489 WP_236613657.1 competence type IV pilus minor pilin ComGF -
  L6430_RS20290 comGE 4039924..4040271 (-) 348 WP_020452174.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6694.49 Da        Isoelectric Point: 5.0637

>NTDB_id=91490 L6430_RS20245 WP_020452165.1 4035425..4035601(+) (sinI) [Bacillus paralicheniformis strain J41TS8]
MNKDKNEKEELDEEWTELIKHALEQGISPDDIRIFLNLGKKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=91490 L6430_RS20245 WP_020452165.1 4035425..4035601(+) (sinI) [Bacillus paralicheniformis strain J41TS8]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGACGATATACGTATTTTTCTCAATTTGGGTAAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment