Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S0I03_RS15280 Genome accession   NZ_CP140613
Coordinates   3077235..3077375 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain WN-I     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3072235..3082375
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S0I03_RS15255 - 3072558..3072941 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  S0I03_RS15260 comA 3072963..3073607 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  S0I03_RS15265 comP 3073688..3076030 (-) 2343 WP_322787765.1 sensor histidine kinase Regulator
  S0I03_RS15270 comX 3076008..3076178 (-) 171 WP_032863917.1 competence pheromone ComX -
  S0I03_RS15275 - 3076178..3077083 (-) 906 WP_014418764.1 polyprenyl synthetase family protein -
  S0I03_RS15280 degQ 3077235..3077375 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  S0I03_RS15285 - 3077841..3078182 (+) 342 WP_014418765.1 hypothetical protein -
  S0I03_RS15290 - 3078189..3079412 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  S0I03_RS15295 - 3079542..3081008 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  S0I03_RS15300 - 3081026..3081577 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  S0I03_RS15305 - 3081674..3082072 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=914861 S0I03_RS15280 WP_003152043.1 3077235..3077375(-) (degQ) [Bacillus velezensis strain WN-I]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=914861 S0I03_RS15280 WP_003152043.1 3077235..3077375(-) (degQ) [Bacillus velezensis strain WN-I]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891