Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   U3P88_RS15135 Genome accession   NZ_CP140297
Coordinates   3155935..3156054 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain UMAF6639     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3150935..3161054
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U3P88_RS15120 (U3P88_15120) - 3152548..3153231 (+) 684 WP_007410267.1 response regulator transcription factor -
  U3P88_RS15125 (U3P88_15125) - 3153218..3154651 (+) 1434 WP_162492834.1 HAMP domain-containing sensor histidine kinase -
  U3P88_RS15130 (U3P88_15130) rapC 3154803..3155951 (+) 1149 WP_033575082.1 Rap family tetratricopeptide repeat protein Regulator
  U3P88_RS15135 (U3P88_15135) phrC 3155935..3156054 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  U3P88_RS15140 (U3P88_15140) - 3156202..3156297 (-) 96 WP_076983091.1 YjcZ family sporulation protein -
  U3P88_RS15145 (U3P88_15145) - 3156392..3157756 (-) 1365 WP_061861151.1 aspartate kinase -
  U3P88_RS15150 (U3P88_15150) ceuB 3158170..3159123 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  U3P88_RS15155 (U3P88_15155) - 3159113..3160060 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  U3P88_RS15160 (U3P88_15160) - 3160054..3160812 (+) 759 WP_061861152.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=913564 U3P88_RS15135 WP_003156334.1 3155935..3156054(+) (phrC) [Bacillus velezensis strain UMAF6639]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=913564 U3P88_RS15135 WP_003156334.1 3155935..3156054(+) (phrC) [Bacillus velezensis strain UMAF6639]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718