Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   U3P88_RS08360 Genome accession   NZ_CP140297
Coordinates   1787882..1788022 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain UMAF6639     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1782882..1793022
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U3P88_RS08335 (U3P88_08335) - 1783196..1783579 (-) 384 WP_061860832.1 hotdog fold thioesterase -
  U3P88_RS08340 (U3P88_08340) comA 1783601..1784245 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  U3P88_RS08345 (U3P88_08345) comP 1784326..1786677 (-) 2352 WP_015418104.1 histidine kinase Regulator
  U3P88_RS08350 (U3P88_08350) comX 1786655..1786825 (-) 171 WP_015418105.1 competence pheromone ComX -
  U3P88_RS08355 (U3P88_08355) - 1786822..1787751 (-) 930 WP_224462816.1 polyprenyl synthetase family protein -
  U3P88_RS08360 (U3P88_08360) degQ 1787882..1788022 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  U3P88_RS08365 (U3P88_08365) - 1788488..1788829 (+) 342 WP_015418107.1 hypothetical protein -
  U3P88_RS08370 (U3P88_08370) - 1788836..1790059 (-) 1224 WP_061860833.1 EAL and HDOD domain-containing protein -
  U3P88_RS08375 (U3P88_08375) - 1790189..1791655 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  U3P88_RS08380 (U3P88_08380) - 1791673..1792224 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  U3P88_RS08385 (U3P88_08385) - 1792321..1792719 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=913539 U3P88_RS08360 WP_003152043.1 1787882..1788022(-) (degQ) [Bacillus velezensis strain UMAF6639]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=913539 U3P88_RS08360 WP_003152043.1 1787882..1788022(-) (degQ) [Bacillus velezensis strain UMAF6639]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891