Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   SR852_RS08155 Genome accession   NZ_CP140161
Coordinates   1634446..1634586 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain ATCC 14580     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1629446..1639586
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SR852_RS08130 (SR852_08130) - 1629547..1629948 (+) 402 WP_003184870.1 YueI family protein -
  SR852_RS08135 (SR852_08135) - 1630133..1630684 (+) 552 WP_003184868.1 cysteine hydrolase family protein -
  SR852_RS08140 (SR852_08140) - 1630702..1632171 (+) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  SR852_RS08145 (SR852_08145) - 1632350..1633570 (+) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  SR852_RS08150 (SR852_08150) - 1633613..1633960 (-) 348 WP_009329512.1 hypothetical protein -
  SR852_RS08155 (SR852_08155) degQ 1634446..1634586 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  SR852_RS08160 (SR852_08160) - 1634775..1635644 (+) 870 WP_011198252.1 polyprenyl synthetase family protein -
  SR852_RS08165 (SR852_08165) comX 1635659..1635823 (+) 165 WP_011198251.1 competence pheromone ComX -
  SR852_RS08170 (SR852_08170) comP 1635863..1638184 (+) 2322 WP_044789735.1 ATP-binding protein Regulator
  SR852_RS08175 (SR852_08175) comA 1638271..1638909 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  SR852_RS08180 (SR852_08180) - 1638926..1639315 (+) 390 WP_003184847.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=913217 SR852_RS08155 WP_003184860.1 1634446..1634586(+) (degQ) [Bacillus licheniformis strain ATCC 14580]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=913217 SR852_RS08155 WP_003184860.1 1634446..1634586(+) (degQ) [Bacillus licheniformis strain ATCC 14580]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652