Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | U2W45_RS05890 | Genome accession | NZ_CP140117 |
| Coordinates | 1169002..1169184 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain NV1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169002..1204012 | 1169002..1169184 | within | 0 |
Gene organization within MGE regions
Location: 1169002..1204012
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U2W45_RS05890 (U2W45_05885) | prx | 1169002..1169184 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| U2W45_RS05895 (U2W45_05890) | sda3 | 1169423..1170223 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| U2W45_RS05900 (U2W45_05895) | - | 1170494..1170928 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| U2W45_RS05905 (U2W45_05900) | - | 1170998..1172203 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| U2W45_RS05910 (U2W45_05905) | - | 1172319..1172546 (-) | 228 | WP_003058873.1 | phage holin | - |
| U2W45_RS05915 (U2W45_05910) | - | 1172543..1172818 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| U2W45_RS05920 (U2W45_05915) | - | 1172828..1173445 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| U2W45_RS05925 (U2W45_05920) | - | 1173442..1173879 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| U2W45_RS05930 (U2W45_05925) | - | 1173891..1175507 (-) | 1617 | WP_015446227.1 | gp58-like family protein | - |
| U2W45_RS09245 | - | 1175514..1175759 (-) | 246 | Protein_1125 | phage tail spike protein | - |
| U2W45_RS05935 (U2W45_05930) | - | 1175756..1176451 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| U2W45_RS05940 (U2W45_05935) | - | 1176448..1178805 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| U2W45_RS05945 (U2W45_05940) | - | 1178805..1179176 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| U2W45_RS05950 (U2W45_05945) | - | 1179191..1179454 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| U2W45_RS05955 (U2W45_05950) | - | 1179465..1180058 (-) | 594 | WP_010922456.1 | tail protein | - |
| U2W45_RS05960 (U2W45_05955) | - | 1180070..1180405 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| U2W45_RS05965 (U2W45_05960) | - | 1180406..1180642 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| U2W45_RS05970 (U2W45_05965) | - | 1180635..1180973 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| U2W45_RS05975 (U2W45_05970) | - | 1180933..1181355 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| U2W45_RS05980 (U2W45_05975) | - | 1181365..1181565 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| U2W45_RS05985 (U2W45_05980) | - | 1181565..1182476 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| U2W45_RS05990 (U2W45_05985) | - | 1182501..1182962 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| U2W45_RS05995 (U2W45_05990) | - | 1183043..1184458 (-) | 1416 | WP_011285619.1 | terminase | - |
| U2W45_RS06000 (U2W45_05995) | - | 1184568..1184834 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| U2W45_RS06005 (U2W45_06000) | - | 1184827..1185006 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| U2W45_RS06010 (U2W45_06005) | - | 1185056..1185280 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| U2W45_RS06015 (U2W45_06010) | - | 1185286..1186779 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| U2W45_RS06020 (U2W45_06015) | - | 1186772..1188040 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| U2W45_RS06025 (U2W45_06020) | - | 1188037..1188393 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| U2W45_RS06030 (U2W45_06025) | - | 1188542..1188886 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| U2W45_RS06035 (U2W45_06030) | - | 1188995..1189414 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| U2W45_RS06040 (U2W45_06035) | - | 1189682..1190317 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| U2W45_RS06045 (U2W45_06040) | - | 1190319..1190588 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| U2W45_RS06050 (U2W45_06045) | - | 1190672..1191184 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| U2W45_RS06055 (U2W45_06050) | - | 1191181..1191522 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| U2W45_RS06060 (U2W45_06055) | - | 1191700..1191867 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| U2W45_RS06065 (U2W45_06060) | - | 1191877..1192674 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| U2W45_RS06070 (U2W45_06065) | - | 1192671..1193600 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| U2W45_RS06075 (U2W45_06070) | - | 1193603..1193932 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| U2W45_RS06080 (U2W45_06075) | - | 1193988..1194194 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| U2W45_RS06085 (U2W45_06080) | - | 1194203..1194343 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| U2W45_RS06090 (U2W45_06085) | - | 1194340..1194573 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| U2W45_RS06095 (U2W45_06090) | - | 1194554..1194943 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| U2W45_RS06100 (U2W45_06095) | - | 1195088..1195327 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| U2W45_RS06105 (U2W45_06100) | - | 1195427..1195612 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| U2W45_RS06110 (U2W45_06105) | - | 1195614..1195925 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| U2W45_RS06115 (U2W45_06110) | - | 1196003..1196188 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| U2W45_RS06120 (U2W45_06115) | - | 1196355..1196594 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| U2W45_RS06125 (U2W45_06120) | - | 1196736..1197542 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| U2W45_RS06130 (U2W45_06125) | - | 1197477..1197743 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| U2W45_RS06135 (U2W45_06130) | - | 1197775..1198491 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| U2W45_RS06140 (U2W45_06135) | - | 1198503..1198694 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| U2W45_RS06145 (U2W45_06140) | - | 1199330..1199425 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| U2W45_RS06150 (U2W45_06145) | - | 1199848..1200195 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| U2W45_RS06155 (U2W45_06150) | - | 1200199..1200579 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| U2W45_RS06160 (U2W45_06155) | - | 1200591..1200857 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| U2W45_RS06165 (U2W45_06160) | - | 1200981..1202123 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| U2W45_RS06170 (U2W45_06165) | - | 1202213..1202488 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| U2W45_RS06175 (U2W45_06170) | - | 1202587..1203174 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| U2W45_RS06180 (U2W45_06175) | - | 1203152..1203994 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=912835 U2W45_RS05890 WP_011017964.1 1169002..1169184(-) (prx) [Streptococcus pyogenes strain NV1]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=912835 U2W45_RS05890 WP_011017964.1 1169002..1169184(-) (prx) [Streptococcus pyogenes strain NV1]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |