Detailed information
Overview
| Name | comYE | Type | Machinery gene |
| Locus tag | SUT_RS01100 | Genome accession | NZ_AP025331 |
| Coordinates | 168073..168366 (+) | Length | 97 a.a. |
| NCBI ID | WP_155963927.1 | Uniprot ID | - |
| Organism | Streptococcus ruminantium strain GUT-183 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 126732..167447 | 168073..168366 | flank | 626 |
Gene organization within MGE regions
Location: 126732..168366
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SUT_RS00800 (GUT183_01290) | - | 126732..128186 (-) | 1455 | WP_237373309.1 | recombinase family protein | - |
| SUT_RS00805 (GUT183_01300) | - | 128314..128982 (-) | 669 | WP_237373311.1 | NYN domain-containing protein | - |
| SUT_RS00810 (GUT183_01310) | - | 129146..129928 (-) | 783 | WP_237373313.1 | XRE family transcriptional regulator | - |
| SUT_RS00815 (GUT183_01340) | - | 130455..130844 (-) | 390 | WP_237373315.1 | DUF2513 domain-containing protein | - |
| SUT_RS00820 (GUT183_01350) | - | 130904..131191 (+) | 288 | WP_237373317.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SUT_RS10220 (GUT183_01360) | - | 131181..131309 (-) | 129 | WP_269089070.1 | hypothetical protein | - |
| SUT_RS00825 (GUT183_01370) | - | 131445..131627 (+) | 183 | WP_237373318.1 | helix-turn-helix domain-containing protein | - |
| SUT_RS00830 (GUT183_01380) | - | 131596..131847 (+) | 252 | WP_419580030.1 | helix-turn-helix transcriptional regulator | - |
| SUT_RS00835 (GUT183_01390) | - | 131860..132117 (+) | 258 | WP_237373319.1 | hypothetical protein | - |
| SUT_RS00840 (GUT183_01400) | - | 132061..132849 (-) | 789 | WP_170244289.1 | TIGR02391 family protein | - |
| SUT_RS00845 (GUT183_01410) | - | 132899..133627 (+) | 729 | WP_237373320.1 | phage antirepressor KilAC domain-containing protein | - |
| SUT_RS00850 (GUT183_01420) | - | 133702..133878 (+) | 177 | WP_237373321.1 | BOW99_gp33 family protein | - |
| SUT_RS00855 (GUT183_01430) | - | 133889..134242 (+) | 354 | WP_237373322.1 | HTH domain-containing protein | - |
| SUT_RS00860 (GUT183_01440) | - | 134481..134741 (+) | 261 | WP_237373323.1 | hypothetical protein | - |
| SUT_RS00865 (GUT183_01450) | - | 134753..134890 (+) | 138 | WP_165437825.1 | hypothetical protein | - |
| SUT_RS00870 (GUT183_01460) | - | 134894..135079 (+) | 186 | WP_237373717.1 | hypothetical protein | - |
| SUT_RS00875 (GUT183_01470) | bet | 135076..135846 (+) | 771 | WP_237373324.1 | phage recombination protein Bet | - |
| SUT_RS00880 (GUT183_01480) | - | 135856..136884 (+) | 1029 | WP_237373326.1 | DUF1351 domain-containing protein | - |
| SUT_RS00885 (GUT183_01490) | - | 136887..137156 (+) | 270 | WP_237373328.1 | hypothetical protein | - |
| SUT_RS00890 (GUT183_01500) | - | 137166..137489 (+) | 324 | WP_237373330.1 | hypothetical protein | - |
| SUT_RS00895 (GUT183_01510) | - | 137482..137721 (+) | 240 | WP_237373332.1 | sporulation protein Cse60 | - |
| SUT_RS00900 (GUT183_01520) | ssb | 137818..138309 (+) | 492 | WP_237373334.1 | single-stranded DNA-binding protein | Machinery gene |
| SUT_RS00905 (GUT183_01530) | - | 138484..138816 (+) | 333 | WP_237373336.1 | hypothetical protein | - |
| SUT_RS00910 (GUT183_01540) | - | 138813..139328 (+) | 516 | WP_237373338.1 | hypothetical protein | - |
| SUT_RS00915 | - | 139489..139722 (+) | 234 | WP_237373673.1 | DUF3310 domain-containing protein | - |
| SUT_RS00920 (GUT183_01560) | - | 139788..140138 (+) | 351 | WP_237373340.1 | hypothetical protein | - |
| SUT_RS00925 (GUT183_01570) | - | 140131..140631 (+) | 501 | WP_237373341.1 | DUF1642 domain-containing protein | - |
| SUT_RS00930 (GUT183_01580) | - | 140628..140873 (+) | 246 | WP_237373344.1 | hypothetical protein | - |
| SUT_RS00935 (GUT183_01600) | - | 140998..141405 (+) | 408 | WP_272877506.1 | YopX family protein | - |
| SUT_RS00940 (GUT183_01610) | - | 141407..141625 (+) | 219 | WP_237373347.1 | hypothetical protein | - |
| SUT_RS00945 (GUT183_01620) | - | 141622..141894 (+) | 273 | WP_237373349.1 | helix-turn-helix domain-containing protein | - |
| SUT_RS00950 (GUT183_01630) | - | 141968..142390 (+) | 423 | WP_237373351.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SUT_RS00955 (GUT183_01640) | - | 142553..143035 (+) | 483 | WP_237373353.1 | terminase | - |
| SUT_RS00960 (GUT183_01650) | - | 142995..144332 (+) | 1338 | WP_237373355.1 | PBSX family phage terminase large subunit | - |
| SUT_RS00965 (GUT183_01660) | - | 144399..145883 (+) | 1485 | WP_237373357.1 | phage portal protein | - |
| SUT_RS00970 (GUT183_01670) | - | 145876..147531 (+) | 1656 | WP_237373359.1 | phage minor capsid protein | - |
| SUT_RS00975 (GUT183_01680) | - | 147524..147781 (+) | 258 | WP_237373361.1 | hypothetical protein | - |
| SUT_RS00980 (GUT183_01690) | - | 147974..148219 (+) | 246 | WP_237373363.1 | hypothetical protein | - |
| SUT_RS00985 (GUT183_01700) | - | 148347..148895 (+) | 549 | WP_237373365.1 | phage scaffolding protein | - |
| SUT_RS00990 (GUT183_01710) | - | 148911..149783 (+) | 873 | WP_155962137.1 | capsid protein | - |
| SUT_RS00995 (GUT183_01720) | - | 149794..149991 (+) | 198 | WP_237373367.1 | hypothetical protein | - |
| SUT_RS01000 (GUT183_01730) | - | 150023..150400 (+) | 378 | WP_156009326.1 | hypothetical protein | - |
| SUT_RS01005 (GUT183_01740) | - | 150400..150741 (+) | 342 | WP_155962131.1 | putative minor capsid protein | - |
| SUT_RS01010 (GUT183_01750) | - | 150741..151085 (+) | 345 | WP_155962129.1 | minor capsid protein | - |
| SUT_RS01015 (GUT183_01760) | - | 151085..151480 (+) | 396 | WP_155962127.1 | minor capsid protein | - |
| SUT_RS01020 (GUT183_01770) | - | 151484..151945 (+) | 462 | WP_155962125.1 | phage tail tube protein | - |
| SUT_RS01025 (GUT183_01780) | - | 151984..152436 (+) | 453 | WP_155962123.1 | hypothetical protein | - |
| SUT_RS01030 (GUT183_01790) | - | 152445..153026 (+) | 582 | WP_155962121.1 | Gp15 family bacteriophage protein | - |
| SUT_RS01035 (GUT183_01800) | - | 153016..156291 (+) | 3276 | WP_237373369.1 | tape measure protein | - |
| SUT_RS01040 (GUT183_01810) | - | 156291..157787 (+) | 1497 | WP_237373371.1 | distal tail protein Dit | - |
| SUT_RS01045 (GUT183_01820) | - | 157788..160388 (+) | 2601 | WP_237373372.1 | hypothetical protein | - |
| SUT_RS01050 (GUT183_01830) | - | 160388..162442 (+) | 2055 | WP_237373373.1 | DUF859 family phage minor structural protein | - |
| SUT_RS01055 (GUT183_01840) | - | 162456..162860 (+) | 405 | WP_155962111.1 | DUF1366 domain-containing protein | - |
| SUT_RS10225 (GUT183_01850) | - | 162880..163011 (+) | 132 | WP_265575086.1 | hypothetical protein | - |
| SUT_RS01060 (GUT183_01860) | - | 163015..163308 (+) | 294 | WP_155962109.1 | DUF7365 family protein | - |
| SUT_RS01065 (GUT183_01870) | - | 163310..163549 (+) | 240 | WP_237373374.1 | phage holin | - |
| SUT_RS01070 (GUT183_01880) | - | 163646..164893 (+) | 1248 | WP_237373375.1 | CHAP domain-containing protein | - |
| SUT_RS01075 (GUT183_01890) | - | 165182..166144 (+) | 963 | WP_237373376.1 | Abi family protein | - |
| SUT_RS01080 (GUT183_01900) | - | 166346..167119 (-) | 774 | WP_336512695.1 | DNA/RNA non-specific endonuclease | - |
| SUT_RS01085 (GUT183_01910) | prx | 167259..167447 (+) | 189 | WP_237373378.1 | Paratox | Regulator |
| SUT_RS01090 (GUT183_01920) | comYC | 167468..167701 (+) | 234 | WP_156009628.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SUT_RS01095 (GUT183_01930) | comGD | 167688..168101 (+) | 414 | WP_024532253.1 | competence type IV pilus minor pilin ComGD | - |
| SUT_RS01100 (GUT183_01940) | comYE | 168073..168366 (+) | 294 | WP_155963927.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
Sequence
Protein
Download Length: 97 a.a. Molecular weight: 10898.87 Da Isoelectric Point: 10.4805
>NTDB_id=91117 SUT_RS01100 WP_155963927.1 168073..168366(+) (comYE) [Streptococcus ruminantium strain GUT-183]
MVVIKNQKNKAYVLLESLVALAVFVAICSLLLSAITTGRRRQAWELKQQEILNLAQMAVQTKQHHLVLNGVEVTVQRSSN
QLVVFHEGKEVLHIAKN
MVVIKNQKNKAYVLLESLVALAVFVAICSLLLSAITTGRRRQAWELKQQEILNLAQMAVQTKQHHLVLNGVEVTVQRSSN
QLVVFHEGKEVLHIAKN
Nucleotide
Download Length: 294 bp
>NTDB_id=91117 SUT_RS01100 WP_155963927.1 168073..168366(+) (comYE) [Streptococcus ruminantium strain GUT-183]
GTGGTCGTTATAAAAAATCAGAAGAATAAGGCCTATGTTTTGCTAGAAAGTTTGGTAGCTTTGGCGGTCTTTGTTGCTAT
TTGTAGCTTGCTTCTATCAGCTATAACTACTGGCCGGAGGCGTCAGGCTTGGGAATTAAAACAACAGGAAATTCTCAATC
TGGCTCAGATGGCTGTGCAGACCAAGCAACATCATTTGGTACTCAATGGTGTGGAGGTGACTGTACAACGGAGTTCAAAT
CAATTAGTCGTTTTTCACGAAGGGAAGGAGGTTTTGCACATTGCTAAAAACTAG
GTGGTCGTTATAAAAAATCAGAAGAATAAGGCCTATGTTTTGCTAGAAAGTTTGGTAGCTTTGGCGGTCTTTGTTGCTAT
TTGTAGCTTGCTTCTATCAGCTATAACTACTGGCCGGAGGCGTCAGGCTTGGGAATTAAAACAACAGGAAATTCTCAATC
TGGCTCAGATGGCTGTGCAGACCAAGCAACATCATTTGGTACTCAATGGTGTGGAGGTGACTGTACAACGGAGTTCAAAT
CAATTAGTCGTTTTTCACGAAGGGAAGGAGGTTTTGCACATTGCTAAAAACTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comYE | Streptococcus mutans UA140 |
52.083 |
98.969 |
0.515 |
| comYE | Streptococcus mutans UA159 |
52.083 |
98.969 |
0.515 |
| comGE/cglE | Streptococcus mitis SK321 |
42.857 |
93.814 |
0.402 |
| comGE/cglE | Streptococcus mitis NCTC 12261 |
42.857 |
93.814 |
0.402 |
| comGE/cglE | Streptococcus pneumoniae D39 |
41.758 |
93.814 |
0.392 |
| comGE/cglE | Streptococcus pneumoniae Rx1 |
41.758 |
93.814 |
0.392 |
| comGE/cglE | Streptococcus pneumoniae R6 |
41.758 |
93.814 |
0.392 |
| comGE/cglE | Streptococcus pneumoniae TIGR4 |
41.758 |
93.814 |
0.392 |
| comGE | Lactococcus lactis subsp. cremoris KW2 |
37.234 |
96.907 |
0.361 |