Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   R6I59_RS17225 Genome accession   NZ_CP139744
Coordinates   3256682..3256822 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate FELIX_MS255     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251682..3261822
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6I59_RS17200 (R6I59_17200) yuxO 3251995..3252375 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  R6I59_RS17205 (R6I59_17205) comA 3252394..3253038 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  R6I59_RS17210 (R6I59_17210) comP 3253119..3255428 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  R6I59_RS17215 (R6I59_17215) comX 3255443..3255610 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  R6I59_RS17220 (R6I59_17220) comQ 3255598..3256497 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  R6I59_RS17225 (R6I59_17225) degQ 3256682..3256822 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  R6I59_RS17230 (R6I59_17230) - 3257044..3257169 (+) 126 WP_003228793.1 hypothetical protein -
  R6I59_RS17235 (R6I59_17235) - 3257283..3257651 (+) 369 WP_003243784.1 hypothetical protein -
  R6I59_RS17240 (R6I59_17240) pdeH 3257627..3258856 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  R6I59_RS17245 (R6I59_17245) pncB 3258993..3260465 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  R6I59_RS17250 (R6I59_17250) pncA 3260481..3261032 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  R6I59_RS17255 (R6I59_17255) yueI 3261129..3261527 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=910838 R6I59_RS17225 WP_003220708.1 3256682..3256822(-) (degQ) [Bacillus subtilis isolate FELIX_MS255]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=910838 R6I59_RS17225 WP_003220708.1 3256682..3256822(-) (degQ) [Bacillus subtilis isolate FELIX_MS255]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1