Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   SD437_RS12270 Genome accession   NZ_CP139565
Coordinates   2475704..2475877 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain NCCP     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2470704..2480877
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SD437_RS12255 gcvT 2471517..2472617 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  SD437_RS12260 - 2473041..2474711 (+) 1671 WP_257988702.1 DEAD/DEAH box helicase -
  SD437_RS12265 - 2474733..2475527 (+) 795 WP_014305407.1 YqhG family protein -
  SD437_RS12270 sinI 2475704..2475877 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  SD437_RS12275 sinR 2475911..2476246 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SD437_RS12280 - 2476294..2477079 (-) 786 WP_017418136.1 TasA family protein -
  SD437_RS12285 - 2477144..2477728 (-) 585 WP_012117977.1 signal peptidase I -
  SD437_RS12290 tapA 2477700..2478371 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  SD437_RS12295 - 2478630..2478959 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  SD437_RS12300 - 2479000..2479179 (-) 180 WP_003153093.1 YqzE family protein -
  SD437_RS12305 comGG 2479236..2479613 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  SD437_RS12310 comGF 2479614..2480009 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  SD437_RS12315 comGE 2480023..2480337 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  SD437_RS12320 comGD 2480321..2480758 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=910221 SD437_RS12270 WP_014418369.1 2475704..2475877(+) (sinI) [Bacillus velezensis strain NCCP]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=910221 SD437_RS12270 WP_014418369.1 2475704..2475877(+) (sinI) [Bacillus velezensis strain NCCP]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719