Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   SD437_RS12320 Genome accession   NZ_CP139565
Coordinates   2480321..2480758 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain NCCP     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2475321..2485758
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SD437_RS12270 sinI 2475704..2475877 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  SD437_RS12275 sinR 2475911..2476246 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SD437_RS12280 - 2476294..2477079 (-) 786 WP_017418136.1 TasA family protein -
  SD437_RS12285 - 2477144..2477728 (-) 585 WP_012117977.1 signal peptidase I -
  SD437_RS12290 tapA 2477700..2478371 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  SD437_RS12295 - 2478630..2478959 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  SD437_RS12300 - 2479000..2479179 (-) 180 WP_003153093.1 YqzE family protein -
  SD437_RS12305 comGG 2479236..2479613 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  SD437_RS12310 comGF 2479614..2480009 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  SD437_RS12315 comGE 2480023..2480337 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  SD437_RS12320 comGD 2480321..2480758 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  SD437_RS12325 comGC 2480748..2481056 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  SD437_RS12330 comGB 2481061..2482098 (-) 1038 WP_345912362.1 competence type IV pilus assembly protein ComGB Machinery gene
  SD437_RS12335 comGA 2482085..2483155 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  SD437_RS12340 - 2483348..2484298 (-) 951 WP_071181848.1 magnesium transporter CorA family protein -
  SD437_RS12345 - 2484444..2485745 (+) 1302 WP_071181849.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=910225 SD437_RS12320 WP_007612572.1 2480321..2480758(-) (comGD) [Bacillus velezensis strain NCCP]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=910225 SD437_RS12320 WP_007612572.1 2480321..2480758(-) (comGD) [Bacillus velezensis strain NCCP]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559