Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   TM2_RS14645 Genome accession   NZ_AP025262
Coordinates   2818904..2819044 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain TM2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2813904..2824044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  TM2_RS14620 (TM2_28340) - 2814226..2814615 (-) 390 WP_008345855.1 hotdog fold thioesterase -
  TM2_RS14625 (TM2_28350) comA 2814639..2815280 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  TM2_RS14630 (TM2_28360) comP 2815361..2817667 (-) 2307 WP_236810048.1 ATP-binding protein Regulator
  TM2_RS14635 (TM2_28370) comX 2817681..2817851 (-) 171 WP_017358941.1 competence pheromone ComX -
  TM2_RS14640 (TM2_28380) - 2817829..2818752 (-) 924 WP_236810049.1 polyprenyl synthetase family protein -
  TM2_RS14645 (TM2_28390) degQ 2818904..2819044 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  TM2_RS14650 (TM2_28400) - 2819550..2819903 (+) 354 WP_019744042.1 hypothetical protein -
  TM2_RS14655 (TM2_28410) - 2819940..2821166 (-) 1227 WP_017358938.1 EAL and HDOD domain-containing protein -
  TM2_RS14660 (TM2_28420) - 2821307..2822776 (-) 1470 WP_017358937.1 nicotinate phosphoribosyltransferase -
  TM2_RS14665 (TM2_28430) - 2822794..2823345 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  TM2_RS14670 (TM2_28440) - 2823406..2823813 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=90781 TM2_RS14645 WP_003213123.1 2818904..2819044(-) (degQ) [Bacillus altitudinis strain TM2]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=90781 TM2_RS14645 WP_003213123.1 2818904..2819044(-) (degQ) [Bacillus altitudinis strain TM2]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment