Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   BSG8_RS12190 Genome accession   NZ_AP025224
Coordinates   2248249..2248596 (-) Length   115 a.a.
NCBI ID   WP_014480255.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. natto strain G8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2243249..2253596
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSG8_RS12145 (BSG8_24090) sinI 2243774..2243947 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  BSG8_RS12150 (BSG8_24100) sinR 2243981..2244316 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSG8_RS12155 (BSG8_24110) tasA 2244409..2245194 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSG8_RS12160 (BSG8_24120) sipW 2245258..2245830 (-) 573 WP_003230181.1 signal peptidase I -
  BSG8_RS12165 (BSG8_24130) tapA 2245814..2246575 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSG8_RS12170 (BSG8_24140) yqzG 2246847..2247173 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSG8_RS12175 (BSG8_24150) spoIIT 2247215..2247394 (-) 180 WP_014480252.1 YqzE family protein -
  BSG8_RS12180 (BSG8_24160) comGG 2247465..2247839 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSG8_RS12185 (BSG8_24170) comGF 2247840..2248223 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSG8_RS12190 (BSG8_24180) comGE 2248249..2248596 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  BSG8_RS12195 (BSG8_24190) comGD 2248580..2249011 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  BSG8_RS12200 (BSG8_24200) comGC 2249001..2249297 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  BSG8_RS12205 (BSG8_24210) comGB 2249311..2250348 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  BSG8_RS12210 (BSG8_24220) comGA 2250335..2251405 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  BSG8_RS12215 (BSG8_24240) - 2251617..2251814 (-) 198 WP_014480259.1 CBS domain-containing protein -
  BSG8_RS12220 (BSG8_24250) corA 2251816..2252769 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13325.35 Da        Isoelectric Point: 4.8952

>NTDB_id=90565 BSG8_RS12190 WP_014480255.1 2248249..2248596(-) (comGE) [Bacillus subtilis subsp. natto strain G8]
MWRENKGFSTIETMSALSLWLFVLLTVVPLWDKLIADEKMAESREIGYQMMNESISKYVMSGEGAASKTITKNNHIYAMK
WEEEGEYQNVCIKATAYKEKSYCLSILQTEWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=90565 BSG8_RS12190 WP_014480255.1 2248249..2248596(-) (comGE) [Bacillus subtilis subsp. natto strain G8]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGTCTGTGGCTGTTTGTGCTGCTGACAGT
CGTCCCCTTGTGGGACAAGCTGATAGCTGATGAAAAAATGGCGGAATCACGAGAAATCGGCTATCAGATGATGAATGAGA
GCATTAGCAAATATGTCATGAGTGGTGAAGGAGCCGCGTCAAAAACGATTACAAAGAACAATCATATCTATGCAATGAAG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGTATCAAAGCCACAGCTTATAAAGAGAAATCATATTGCCTCAGCATCCT
GCAGACAGAATGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

96.522

100

0.965

Multiple sequence alignment