Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BSG8_RS12145 | Genome accession | NZ_AP025224 |
| Coordinates | 2243774..2243947 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. natto strain G8 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2238774..2248947
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSG8_RS12130 (BSG8_24060) | gcvT | 2239573..2240661 (-) | 1089 | WP_014480247.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BSG8_RS12135 (BSG8_24070) | yqhH | 2241103..2242776 (+) | 1674 | WP_014480248.1 | SNF2-related protein | - |
| BSG8_RS12140 (BSG8_24080) | yqhG | 2242797..2243591 (+) | 795 | WP_014480249.1 | YqhG family protein | - |
| BSG8_RS12145 (BSG8_24090) | sinI | 2243774..2243947 (+) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| BSG8_RS12150 (BSG8_24100) | sinR | 2243981..2244316 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| BSG8_RS12155 (BSG8_24110) | tasA | 2244409..2245194 (-) | 786 | WP_014480250.1 | biofilm matrix protein TasA | - |
| BSG8_RS12160 (BSG8_24120) | sipW | 2245258..2245830 (-) | 573 | WP_003230181.1 | signal peptidase I | - |
| BSG8_RS12165 (BSG8_24130) | tapA | 2245814..2246575 (-) | 762 | WP_014480251.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BSG8_RS12170 (BSG8_24140) | yqzG | 2246847..2247173 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| BSG8_RS12175 (BSG8_24150) | spoIIT | 2247215..2247394 (-) | 180 | WP_014480252.1 | YqzE family protein | - |
| BSG8_RS12180 (BSG8_24160) | comGG | 2247465..2247839 (-) | 375 | WP_014480253.1 | ComG operon protein ComGG | Machinery gene |
| BSG8_RS12185 (BSG8_24170) | comGF | 2247840..2248223 (-) | 384 | WP_014480254.1 | ComG operon protein ComGF | Machinery gene |
| BSG8_RS12190 (BSG8_24180) | comGE | 2248249..2248596 (-) | 348 | WP_014480255.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=90561 BSG8_RS12145 WP_003230187.1 2243774..2243947(+) (sinI) [Bacillus subtilis subsp. natto strain G8]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=90561 BSG8_RS12145 WP_003230187.1 2243774..2243947(+) (sinI) [Bacillus subtilis subsp. natto strain G8]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |