Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BSG8_RS12145 Genome accession   NZ_AP025224
Coordinates   2243774..2243947 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. natto strain G8     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2238774..2248947
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSG8_RS12130 (BSG8_24060) gcvT 2239573..2240661 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  BSG8_RS12135 (BSG8_24070) yqhH 2241103..2242776 (+) 1674 WP_014480248.1 SNF2-related protein -
  BSG8_RS12140 (BSG8_24080) yqhG 2242797..2243591 (+) 795 WP_014480249.1 YqhG family protein -
  BSG8_RS12145 (BSG8_24090) sinI 2243774..2243947 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  BSG8_RS12150 (BSG8_24100) sinR 2243981..2244316 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BSG8_RS12155 (BSG8_24110) tasA 2244409..2245194 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  BSG8_RS12160 (BSG8_24120) sipW 2245258..2245830 (-) 573 WP_003230181.1 signal peptidase I -
  BSG8_RS12165 (BSG8_24130) tapA 2245814..2246575 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  BSG8_RS12170 (BSG8_24140) yqzG 2246847..2247173 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BSG8_RS12175 (BSG8_24150) spoIIT 2247215..2247394 (-) 180 WP_014480252.1 YqzE family protein -
  BSG8_RS12180 (BSG8_24160) comGG 2247465..2247839 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  BSG8_RS12185 (BSG8_24170) comGF 2247840..2248223 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  BSG8_RS12190 (BSG8_24180) comGE 2248249..2248596 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=90561 BSG8_RS12145 WP_003230187.1 2243774..2243947(+) (sinI) [Bacillus subtilis subsp. natto strain G8]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=90561 BSG8_RS12145 WP_003230187.1 2243774..2243947(+) (sinI) [Bacillus subtilis subsp. natto strain G8]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment