Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   SE146_RS02365 Genome accession   NZ_CP138339
Coordinates   451723..452196 (+) Length   157 a.a.
NCBI ID   WP_012503482.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain TH2288     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 452266..508508 451723..452196 flank 70


Gene organization within MGE regions


Location: 451723..508508
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SE146_RS02365 (SE146_02355) pilL 451723..452196 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  SE146_RS02370 (SE146_02360) - 452266..452574 (-) 309 WP_025456241.1 AzlD family protein -
  SE146_RS02375 (SE146_02365) - 452571..453280 (-) 710 Protein_461 AzlC family ABC transporter permease -
  SE146_RS02380 (SE146_02370) dut 453446..453898 (+) 453 WP_003687923.1 dUTP diphosphatase -
  SE146_RS02385 (SE146_02375) dapC 453976..455163 (+) 1188 WP_123771553.1 succinyldiaminopimelate transaminase -
  SE146_RS02390 (SE146_02380) yaaA 455319..456098 (+) 780 WP_047917077.1 peroxide stress protein YaaA -
  SE146_RS02405 (SE146_02395) - 456628..457820 (+) 1193 Protein_465 tyrosine-type recombinase/integrase -
  SE146_RS02410 (SE146_02400) - 458176..458445 (-) 270 WP_003687928.1 hypothetical protein -
  SE146_RS02415 (SE146_02405) - 458640..459323 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  SE146_RS02420 (SE146_02410) - 459604..459870 (-) 267 Protein_468 hypothetical protein -
  SE146_RS02425 (SE146_02415) - 459981..460196 (-) 216 WP_003691538.1 hypothetical protein -
  SE146_RS02430 (SE146_02420) - 460248..460739 (-) 492 WP_017147227.1 siphovirus Gp157 family protein -
  SE146_RS02435 (SE146_02425) - 460736..460918 (-) 183 WP_003691535.1 hypothetical protein -
  SE146_RS02440 (SE146_02430) - 461058..461744 (-) 687 WP_003691532.1 phage replication initiation protein, NGO0469 family -
  SE146_RS02445 (SE146_02435) - 461813..461974 (-) 162 WP_003691530.1 hypothetical protein -
  SE146_RS02450 (SE146_02440) - 461971..462246 (-) 276 WP_003703838.1 NGO1622 family putative holin -
  SE146_RS02455 (SE146_02445) - 462399..462731 (-) 333 WP_003696914.1 hypothetical protein -
  SE146_RS02460 (SE146_02450) - 462872..463159 (-) 288 WP_272656731.1 hypothetical protein -
  SE146_RS02465 (SE146_02455) - 463156..463632 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  SE146_RS02470 (SE146_02460) - 463665..463865 (-) 201 WP_003704298.1 hypothetical protein -
  SE146_RS02475 (SE146_02465) - 464063..464476 (-) 414 WP_003687963.1 hypothetical protein -
  SE146_RS02480 (SE146_02470) - 464473..464934 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  SE146_RS02485 (SE146_02475) - 464951..465388 (-) 438 WP_003687967.1 hypothetical protein -
  SE146_RS02490 (SE146_02480) - 465501..466217 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  SE146_RS02495 (SE146_02485) - 466292..466522 (+) 231 WP_020997318.1 Cro/CI family transcriptional regulator -
  SE146_RS02500 (SE146_02490) - 466602..466757 (+) 156 WP_003691446.1 hypothetical protein -
  SE146_RS02505 (SE146_02495) - 466734..466922 (-) 189 WP_003706568.1 hypothetical protein -
  SE146_RS02510 (SE146_02500) - 467095..467322 (+) 228 WP_047949281.1 helix-turn-helix domain-containing protein -
  SE146_RS02515 (SE146_02505) - 467319..468329 (+) 1011 WP_319078238.1 helix-turn-helix domain-containing protein -
  SE146_RS02520 (SE146_02510) - 468344..469126 (+) 783 WP_025456432.1 ATP-binding protein -
  SE146_RS02525 (SE146_02515) - 469196..469402 (+) 207 WP_184982621.1 hypothetical protein -
  SE146_RS02530 (SE146_02520) - 469441..469935 (+) 495 WP_047923242.1 DUF3310 domain-containing protein -
  SE146_RS02535 (SE146_02525) - 470112..470261 (+) 150 WP_003689110.1 hypothetical protein -
  SE146_RS02540 (SE146_02530) - 470290..470571 (+) 282 WP_003689109.1 hypothetical protein -
  SE146_RS02545 (SE146_02535) - 470562..470942 (+) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  SE146_RS02550 (SE146_02540) - 470959..471087 (-) 129 WP_012503747.1 hypothetical protein -
  SE146_RS02555 (SE146_02545) - 471209..471616 (+) 408 WP_123768252.1 hypothetical protein -
  SE146_RS02560 (SE146_02550) - 471677..472636 (+) 960 WP_123768253.1 hypothetical protein -
  SE146_RS02565 (SE146_02555) - 473131..474018 (+) 888 WP_123768254.1 KilA-N domain-containing protein -
  SE146_RS02570 (SE146_02560) - 474311..474760 (+) 450 WP_003689093.1 hypothetical protein -
  SE146_RS02575 (SE146_02565) terL 474822..476243 (+) 1422 WP_003689090.1 phage terminase large subunit -
  SE146_RS02580 (SE146_02570) - 476240..478387 (+) 2148 WP_003691423.1 phage portal protein -
  SE146_RS02585 (SE146_02575) - 478455..479612 (+) 1158 WP_010360058.1 HK97 family phage prohead protease -
  SE146_RS02590 (SE146_02580) - 479653..481152 (+) 1500 WP_003689084.1 hypothetical protein -
  SE146_RS02595 (SE146_02585) - 481159..481521 (+) 363 WP_003689082.1 hypothetical protein -
  SE146_RS02600 (SE146_02590) - 481524..482054 (+) 531 WP_003689080.1 head-tail connector protein -
  SE146_RS02605 (SE146_02595) - 482054..482536 (+) 483 WP_047919355.1 HK97 gp10 family phage protein -
  SE146_RS02610 (SE146_02600) - 482533..482961 (+) 429 WP_003689076.1 hypothetical protein -
  SE146_RS02615 (SE146_02605) - 482987..483760 (+) 774 WP_003691416.1 hypothetical protein -
  SE146_RS02620 (SE146_02610) - 483821..484150 (+) 330 WP_003692871.1 hypothetical protein -
  SE146_RS02625 (SE146_02615) - 484162..484428 (+) 267 WP_003689070.1 hypothetical protein -
  SE146_RS02630 (SE146_02620) - 484428..485027 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  SE146_RS02635 (SE146_02625) - 485024..485878 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  SE146_RS02640 (SE146_02630) - 485880..486311 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  SE146_RS02645 (SE146_02635) - 486339..486617 (-) 279 WP_003692877.1 helix-turn-helix domain-containing protein -
  SE146_RS02650 (SE146_02640) - 486857..491002 (+) 4146 WP_319078478.1 phage tail protein -
  SE146_RS02655 (SE146_02645) - 491114..491419 (+) 306 WP_003689058.1 hypothetical protein -
  SE146_RS02660 (SE146_02650) - 491490..491960 (+) 471 WP_003689057.1 hypothetical protein -
  SE146_RS02665 (SE146_02655) - 491961..492293 (+) 333 WP_003691408.1 hypothetical protein -
  SE146_RS02670 (SE146_02660) - 492454..492594 (+) 141 WP_154235581.1 hypothetical protein -
  SE146_RS02675 (SE146_02665) - 492649..492996 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  SE146_RS02680 (SE146_02670) - 492996..493232 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  SE146_RS02685 (SE146_02675) - 493272..493397 (+) 126 WP_255294325.1 hypothetical protein -
  SE146_RS02690 (SE146_02680) - 493439..493978 (+) 540 WP_319078479.1 TIGR02594 family protein -
  SE146_RS02695 (SE146_02685) - 493979..494323 (+) 345 WP_003695464.1 hypothetical protein -
  SE146_RS02700 (SE146_02690) - 494307..494480 (+) 174 WP_017146757.1 hypothetical protein -
  SE146_RS02705 (SE146_02695) - 494792..494941 (+) 150 WP_003691402.1 hypothetical protein -
  SE146_RS02710 (SE146_02700) - 494971..498015 (+) 3045 WP_319078480.1 tape measure protein -
  SE146_RS02715 (SE146_02705) - 498075..498554 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  SE146_RS02720 (SE146_02710) - 498896..499885 (-) 990 WP_003689040.1 site-specific integrase -
  SE146_RS02725 - 500145..500333 (-) 189 WP_003689039.1 hypothetical protein -
  SE146_RS02730 (SE146_02715) purM 500574..501608 (+) 1035 WP_047923885.1 phosphoribosylformylglycinamidine cyclo-ligase -
  SE146_RS02735 (SE146_02720) - 501826..502131 (+) 306 WP_047953262.1 hypothetical protein -
  SE146_RS02740 (SE146_02725) - 502225..502530 (+) 306 WP_082294427.1 hypothetical protein -
  SE146_RS02745 (SE146_02730) - 502608..503261 (+) 654 WP_250333196.1 IS1595 family transposase -
  SE146_RS02750 (SE146_02735) - 503395..505422 (+) 2028 WP_003689037.1 BCCT family transporter -
  SE146_RS02755 (SE146_02740) - 505511..507064 (-) 1554 WP_003689036.1 fatty acid--CoA ligase -
  SE146_RS02760 (SE146_02745) - 507115..507243 (+) 129 WP_255294324.1 hypothetical protein -
  SE146_RS02765 (SE146_02750) - 507315..508508 (-) 1194 WP_003689034.1 SGNH/GDSL hydrolase family protein -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17486.30 Da        Isoelectric Point: 9.9561

>NTDB_id=901918 SE146_RS02365 WP_012503482.1 451723..452196(+) (pilL) [Neisseria gonorrhoeae strain TH2288]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=901918 SE146_RS02365 WP_012503482.1 451723..452196(+) (pilL) [Neisseria gonorrhoeae strain TH2288]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.72

100

0.917
  pilX Neisseria meningitidis 8013

85.35

100

0.854