Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   RA179_RS12630 Genome accession   NZ_CP138201
Coordinates   2482054..2482401 (-) Length   115 a.a.
NCBI ID   WP_106020095.1    Uniprot ID   -
Organism   Bacillus halotolerans strain DY299     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2477054..2487401
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RA179_RS12585 (RA179_12585) sinI 2477579..2477752 (+) 174 WP_024122036.1 anti-repressor SinI family protein Regulator
  RA179_RS12590 (RA179_12590) sinR 2477786..2478121 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RA179_RS12595 (RA179_12595) tasA 2478208..2478993 (-) 786 WP_106020091.1 biofilm matrix protein TasA -
  RA179_RS12600 (RA179_12600) - 2479058..2479642 (-) 585 WP_105955579.1 signal peptidase I -
  RA179_RS12605 (RA179_12605) tapA 2479614..2480375 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  RA179_RS12610 (RA179_12610) - 2480653..2480976 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  RA179_RS12615 (RA179_12615) - 2481019..2481198 (-) 180 WP_003236949.1 YqzE family protein -
  RA179_RS12620 (RA179_12620) comGG 2481270..2481644 (-) 375 WP_106020094.1 competence type IV pilus minor pilin ComGG Machinery gene
  RA179_RS12625 (RA179_12625) comGF 2481645..2482028 (-) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  RA179_RS12630 (RA179_12630) comGE 2482054..2482401 (-) 348 WP_106020095.1 competence type IV pilus minor pilin ComGE Machinery gene
  RA179_RS12635 (RA179_12635) comGD 2482385..2482816 (-) 432 WP_255003480.1 competence type IV pilus minor pilin ComGD Machinery gene
  RA179_RS12640 (RA179_12640) comGC 2482806..2483102 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  RA179_RS12645 (RA179_12645) comGB 2483116..2484153 (-) 1038 WP_106020096.1 competence type IV pilus assembly protein ComGB Machinery gene
  RA179_RS12650 (RA179_12650) comGA 2484140..2485210 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  RA179_RS12655 (RA179_12655) - 2485531..2485941 (-) 411 WP_106020097.1 CBS domain-containing protein -
  RA179_RS12660 (RA179_12660) - 2486004..2486957 (-) 954 WP_255003483.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13239.09 Da        Isoelectric Point: 4.3566

>NTDB_id=901349 RA179_RS12630 WP_106020095.1 2482054..2482401(-) (comGE) [Bacillus halotolerans strain DY299]
MWRENKGFSTIETMAALSIWLFMLLTIVPLWNKLIADEHIAESREMGYQLVNESIGKYMLTGAGDSSQTVSMNNSKYSMT
WEEEGEYQNVCITSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=901349 RA179_RS12630 WP_106020095.1 2482054..2482401(-) (comGE) [Bacillus halotolerans strain DY299]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGGCTGCCCTCAGCATATGGCTGTTTATGCTTCTGACGAT
CGTGCCGTTGTGGAACAAGCTGATAGCTGATGAACATATAGCGGAGTCGCGAGAAATGGGTTATCAGCTTGTTAATGAAA
GCATAGGCAAATATATGCTGACAGGAGCAGGAGATTCGTCACAAACTGTTTCGATGAACAATAGCAAATACTCGATGACA
TGGGAGGAGGAGGGAGAGTATCAAAACGTATGCATCACATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

70.435

100

0.704