Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   R7892_RS00820 Genome accession   NZ_CP137688
Coordinates   167751..168305 (+) Length   184 a.a.
NCBI ID   WP_216547288.1    Uniprot ID   -
Organism   Ligilactobacillus murinus strain KD6     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 139761..200467 167751..168305 within 0


Gene organization within MGE regions


Location: 139761..200467
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R7892_RS00740 (R7892_00740) - 149253..151151 (+) 1899 WP_318239697.1 hypothetical protein -
  R7892_RS00745 (R7892_00745) - 151271..152224 (-) 954 Protein_140 SdrD B-like domain-containing protein -
  R7892_RS00750 (R7892_00750) - 152313..152720 (+) 408 WP_318239698.1 hypothetical protein -
  R7892_RS10915 - 152933..153049 (-) 117 Protein_142 KxYKxGKxW signal peptide domain-containing protein -
  R7892_RS00755 (R7892_00755) - 153495..154421 (+) 927 WP_289190525.1 NADPH-dependent FMN reductase -
  R7892_RS00760 (R7892_00760) - 154421..155392 (+) 972 WP_289190526.1 FAD:protein FMN transferase -
  R7892_RS00765 (R7892_00765) - 155515..156351 (-) 837 WP_010690081.1 YidC/Oxa1 family membrane protein insertase -
  R7892_RS00770 (R7892_00770) rnpA 156363..156719 (-) 357 WP_004049716.1 ribonuclease P protein component -
  R7892_RS00775 (R7892_00775) rpmH 156785..156919 (-) 135 WP_003701411.1 50S ribosomal protein L34 -
  R7892_RS00780 (R7892_00780) dnaA 157438..158784 (+) 1347 WP_289190528.1 chromosomal replication initiator protein DnaA -
  R7892_RS00785 (R7892_00785) dnaN 158959..160098 (+) 1140 WP_289190529.1 DNA polymerase III subunit beta -
  R7892_RS00790 (R7892_00790) yaaA 160348..160572 (+) 225 WP_318239699.1 S4 domain-containing protein YaaA -
  R7892_RS00795 (R7892_00795) recF 160581..161798 (+) 1218 WP_318239700.1 DNA replication/repair protein RecF -
  R7892_RS00800 (R7892_00800) gyrB 161819..163777 (+) 1959 WP_137420738.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  R7892_RS00805 (R7892_00805) gyrA 163887..166349 (+) 2463 WP_289190531.1 DNA gyrase subunit A -
  R7892_RS00810 (R7892_00810) - 166448..167083 (-) 636 WP_289190532.1 NAD(P)-dependent oxidoreductase -
  R7892_RS00815 (R7892_00815) rpsF 167424..167714 (+) 291 WP_004049701.1 30S ribosomal protein S6 -
  R7892_RS00820 (R7892_00820) ssb 167751..168305 (+) 555 WP_216547288.1 single-stranded DNA-binding protein Machinery gene
  R7892_RS00825 (R7892_00825) rpsR 168327..168563 (+) 237 WP_003695889.1 30S ribosomal protein S18 -
  R7892_RS00830 (R7892_00830) - 169123..169653 (-) 531 WP_289190533.1 hypothetical protein -
  R7892_RS00835 (R7892_00835) - 169814..170020 (+) 207 WP_289190534.1 hypothetical protein -
  R7892_RS00840 (R7892_00840) - 170107..171090 (-) 984 WP_289190535.1 DUF1002 domain-containing protein -
  R7892_RS00845 (R7892_00845) pnuC 171369..172139 (+) 771 WP_137420745.1 nicotinamide riboside transporter PnuC -
  R7892_RS00850 (R7892_00850) - 172380..174395 (+) 2016 WP_318239701.1 DHH family phosphoesterase -
  R7892_RS00855 (R7892_00855) rplI 174423..174872 (+) 450 WP_318239702.1 50S ribosomal protein L9 -
  R7892_RS00860 (R7892_00860) - 174944..176104 (-) 1161 WP_318239703.1 ImmA/IrrE family metallo-endopeptidase -
  R7892_RS00865 (R7892_00865) - 176661..177554 (+) 894 WP_318239704.1 ABC transporter ATP-binding protein -
  R7892_RS00870 (R7892_00870) - 177558..178466 (+) 909 WP_318239705.1 ABC transporter permease -
  R7892_RS00875 (R7892_00875) - 178490..179374 (-) 885 WP_318239706.1 LysR family transcriptional regulator -
  R7892_RS00880 (R7892_00880) - 179497..180417 (+) 921 WP_318239707.1 DMT family transporter -
  R7892_RS00885 (R7892_00885) - 180508..181134 (-) 627 WP_318239708.1 XRE family transcriptional regulator -
  R7892_RS00890 (R7892_00890) - 181281..181487 (+) 207 WP_135942522.1 hypothetical protein -
  R7892_RS00895 (R7892_00895) - 181484..181738 (+) 255 WP_153551214.1 hypothetical protein -
  R7892_RS00900 (R7892_00900) - 181809..183893 (+) 2085 WP_318239709.1 glycoside hydrolase domain-containing protein -
  R7892_RS00905 (R7892_00905) - 185424..186041 (-) 618 WP_318239710.1 hypothetical protein -
  R7892_RS00910 (R7892_00910) - 186195..187760 (+) 1566 WP_318239711.1 ABC transporter ATP-binding protein -
  R7892_RS00915 (R7892_00915) - 187757..189421 (+) 1665 WP_318239712.1 ABC transporter ATP-binding protein -
  R7892_RS00920 (R7892_00920) dnaB 189526..190914 (+) 1389 WP_278876118.1 replicative DNA helicase -
  R7892_RS00925 (R7892_00925) asnB 190983..192860 (+) 1878 WP_278876116.1 asparagine synthase (glutamine-hydrolyzing) -
  R7892_RS00930 (R7892_00930) - 193464..194318 (-) 855 WP_318239713.1 hypothetical protein -
  R7892_RS00935 (R7892_00935) - 194539..194685 (+) 147 WP_318239714.1 type A2 lanthipeptide -
  R7892_RS00940 (R7892_00940) - 194777..197596 (+) 2820 WP_318239715.1 type 2 lanthipeptide synthetase LanM family protein -
  R7892_RS00945 (R7892_00945) - 197593..199722 (+) 2130 WP_318239716.1 peptidase domain-containing ABC transporter -
  R7892_RS00950 (R7892_00950) - 199727..200467 (+) 741 WP_289190556.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 184 a.a.        Molecular weight: 20118.82 Da        Isoelectric Point: 4.6382

>NTDB_id=899774 R7892_RS00820 WP_216547288.1 167751..168305(+) (ssb) [Ligilactobacillus murinus strain KD6]
MINSVVLVGRLTRDPELRYTPSGAAVASFTVAIDRRFTNQQGQREADFINCVMWRKAAENFANFTHKGSLVGIEGRIQTR
SYENQQGQRVYVTEVLAENFSLLESKAESERYRAQHGSSNANVQGSAPSNDMQSSNPFGTPANNQTNDAFGGNGFDTNTN
NSNNAADPFAGGQQIDISDDDLPF

Nucleotide


Download         Length: 555 bp        

>NTDB_id=899774 R7892_RS00820 WP_216547288.1 167751..168305(+) (ssb) [Ligilactobacillus murinus strain KD6]
TTGATCAATTCAGTTGTTCTAGTAGGTCGTTTGACCCGAGATCCTGAACTGCGCTATACGCCTTCAGGGGCAGCCGTGGC
AAGCTTTACTGTCGCGATCGACCGTCGTTTCACTAACCAACAAGGTCAACGTGAAGCTGATTTCATCAATTGCGTAATGT
GGCGTAAAGCAGCCGAAAACTTCGCTAACTTTACCCACAAAGGTTCCTTAGTTGGGATCGAAGGACGGATCCAAACCCGT
TCTTATGAAAATCAGCAAGGTCAACGTGTTTATGTTACTGAAGTTTTAGCTGAGAATTTCTCACTTTTGGAATCCAAGGC
TGAATCAGAAAGGTATCGTGCCCAACACGGCAGCAGTAACGCTAATGTGCAAGGTTCAGCTCCTTCAAATGATATGCAGT
CATCTAATCCATTTGGGACTCCAGCAAATAATCAGACCAATGATGCTTTTGGTGGTAATGGTTTTGATACCAATACAAAC
AATAGTAACAATGCTGCTGATCCATTTGCCGGTGGTCAACAGATCGATATCTCGGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

61.622

100

0.62

  ssbA Bacillus subtilis subsp. subtilis str. 168

56.684

100

0.576