Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   R6Y88_RS15875 Genome accession   NZ_CP137687
Coordinates   3146247..3146387 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain YT-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3141247..3151387
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6Y88_RS15845 yueI 3141541..3141939 (+) 399 WP_015483635.1 YueI family protein -
  R6Y88_RS15850 pncA 3142036..3142587 (+) 552 WP_014477836.1 cysteine hydrolase family protein -
  R6Y88_RS15855 pncB 3142603..3144075 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  R6Y88_RS15860 pdeH 3144212..3145441 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  R6Y88_RS15865 - 3145417..3145785 (-) 369 WP_015483634.1 hypothetical protein -
  R6Y88_RS15870 - 3145963..3146025 (-) 63 Protein_3081 hypothetical protein -
  R6Y88_RS15875 degQ 3146247..3146387 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  R6Y88_RS15880 - 3146572..3147432 (+) 861 WP_015483633.1 polyprenyl synthetase family protein -
  R6Y88_RS15885 comX 3147445..3147609 (+) 165 WP_015384519.1 competence pheromone ComX -
  R6Y88_RS15890 comP 3147621..3149921 (+) 2301 WP_046340263.1 histidine kinase Regulator
  R6Y88_RS15895 comA 3150002..3150646 (+) 645 WP_375060239.1 two-component system response regulator ComA Regulator
  R6Y88_RS15900 yuxO 3150664..3151044 (+) 381 WP_015483631.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=899745 R6Y88_RS15875 WP_003220708.1 3146247..3146387(+) (degQ) [Bacillus subtilis strain YT-4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=899745 R6Y88_RS15875 WP_003220708.1 3146247..3146387(+) (degQ) [Bacillus subtilis strain YT-4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1