Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ABC807_RS08420 Genome accession   NZ_CP156625
Coordinates   1618828..1618977 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain TL7/1993     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1613828..1623977
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABC807_RS08390 (ABC807_08390) - 1613951..1614562 (-) 612 WP_000638370.1 type II CAAX endopeptidase family protein -
  ABC807_RS08395 (ABC807_08395) - 1614744..1616090 (-) 1347 WP_025168898.1 IS1380-like element ISSpn5 family transposase -
  ABC807_RS08400 (ABC807_08400) blpZ 1616421..1616654 (-) 234 WP_000276498.1 immunity protein BlpZ -
  ABC807_RS08405 (ABC807_08405) - 1616696..1617385 (-) 690 WP_000760521.1 CPBP family intramembrane glutamic endopeptidase -
  ABC807_RS08410 (ABC807_08410) - 1617400..1617819 (-) 420 WP_000877385.1 hypothetical protein -
  ABC807_RS08415 (ABC807_08415) - 1618605..1618724 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  ABC807_RS08420 (ABC807_08420) cipB 1618828..1618977 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  ABC807_RS08425 (ABC807_08425) blpN 1619221..1619424 (-) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ABC807_RS08430 (ABC807_08430) blpM 1619440..1619694 (-) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  ABC807_RS08435 (ABC807_08435) - 1619844..1620648 (-) 805 Protein_1620 IS5 family transposase -
  ABC807_RS08440 (ABC807_08440) - 1620846..1621250 (-) 405 WP_000846944.1 hypothetical protein -
  ABC807_RS08445 (ABC807_08445) - 1621247..1621411 (-) 165 WP_000727118.1 hypothetical protein -
  ABC807_RS08450 (ABC807_08450) - 1621708..1621827 (-) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  ABC807_RS08455 (ABC807_08455) blpU 1621830..1622060 (-) 231 WP_000379964.1 bacteriocin-like peptide BlpU -
  ABC807_RS08460 (ABC807_08460) blpJ 1622129..1622398 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  ABC807_RS08465 (ABC807_08465) blpI 1622865..1623062 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  ABC807_RS08470 (ABC807_08470) comA/nlmT 1623344..1623931 (+) 588 WP_001810228.1 cysteine peptidase family C39 domain-containing protein Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=899718 ABC807_RS08420 WP_001809846.1 1618828..1618977(-) (cipB) [Streptococcus pneumoniae strain TL7/1993]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=899718 ABC807_RS08420 WP_001809846.1 1618828..1618977(-) (cipB) [Streptococcus pneumoniae strain TL7/1993]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531