Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   R6U75_RS04380 Genome accession   NZ_CP137627
Coordinates   848309..848791 (+) Length   160 a.a.
NCBI ID   WP_199875575.1    Uniprot ID   -
Organism   Pediococcus pentosaceus strain LA0061     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 838417..877900 848309..848791 within 0


Gene organization within MGE regions


Location: 838417..877900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6U75_RS04305 (R6U75_04300) - 838417..839589 (-) 1173 WP_199875583.1 site-specific integrase -
  R6U75_RS04310 (R6U75_04305) - 839686..839988 (-) 303 WP_029257881.1 hypothetical protein -
  R6U75_RS04315 (R6U75_04310) - 840077..841147 (-) 1071 WP_199875582.1 DUF4236 domain-containing protein -
  R6U75_RS04320 (R6U75_04315) - 841262..842242 (-) 981 WP_199875581.1 hypothetical protein -
  R6U75_RS04325 (R6U75_04320) - 842304..842711 (-) 408 WP_199875580.1 ImmA/IrrE family metallo-endopeptidase -
  R6U75_RS04330 (R6U75_04325) - 842723..843094 (-) 372 WP_176932925.1 helix-turn-helix domain-containing protein -
  R6U75_RS04335 (R6U75_04330) - 843246..843497 (+) 252 WP_249704015.1 helix-turn-helix domain-containing protein -
  R6U75_RS04340 (R6U75_04335) - 843494..843715 (+) 222 WP_199875579.1 hypothetical protein -
  R6U75_RS04345 (R6U75_04340) - 843789..844247 (+) 459 WP_229572679.1 helix-turn-helix domain-containing protein -
  R6U75_RS04350 (R6U75_04345) - 844248..844523 (+) 276 WP_199875578.1 helix-turn-helix domain-containing protein -
  R6U75_RS04355 (R6U75_04350) - 844761..845042 (+) 282 WP_141822573.1 hypothetical protein -
  R6U75_RS04360 (R6U75_04355) bet 845035..845799 (+) 765 WP_094104559.1 phage recombination protein Bet -
  R6U75_RS04365 (R6U75_04360) - 845759..846604 (+) 846 WP_234417758.1 PD-(D/E)XK nuclease-like domain-containing protein -
  R6U75_RS04370 (R6U75_04365) - 846615..847445 (+) 831 WP_199875577.1 helix-turn-helix domain-containing protein -
  R6U75_RS04375 (R6U75_04370) - 847449..848144 (+) 696 WP_199875576.1 putative HNHc nuclease -
  R6U75_RS04380 (R6U75_04375) ssb 848309..848791 (+) 483 WP_199875575.1 single-stranded DNA-binding protein Machinery gene
  R6U75_RS04385 (R6U75_04380) - 848867..849268 (+) 402 WP_234417756.1 hypothetical protein -
  R6U75_RS04390 (R6U75_04385) - 849280..849573 (+) 294 WP_199875574.1 hypothetical protein -
  R6U75_RS04395 (R6U75_04390) - 849574..850140 (+) 567 WP_199875573.1 DUF1642 domain-containing protein -
  R6U75_RS04400 (R6U75_04395) - 850133..850300 (+) 168 WP_199875572.1 hypothetical protein -
  R6U75_RS04405 (R6U75_04400) - 850448..850690 (+) 243 WP_199875571.1 hypothetical protein -
  R6U75_RS04410 (R6U75_04405) - 851062..851505 (+) 444 WP_094104548.1 hypothetical protein -
  R6U75_RS04420 (R6U75_04415) - 851841..852665 (+) 825 WP_199875570.1 DUF5677 domain-containing protein -
  R6U75_RS04425 (R6U75_04420) - 852662..852838 (+) 177 WP_199875569.1 hypothetical protein -
  R6U75_RS04430 (R6U75_04425) - 852838..853518 (+) 681 WP_199875568.1 terminase gpP N-terminus-related DNA-binding protein -
  R6U75_RS04435 (R6U75_04430) - 853515..854888 (+) 1374 WP_234417754.1 PBSX family phage terminase large subunit -
  R6U75_RS04440 (R6U75_04435) - 854942..856438 (+) 1497 WP_234417752.1 phage portal protein -
  R6U75_RS04445 (R6U75_04440) - 856435..857568 (+) 1134 WP_199875566.1 phage minor capsid protein -
  R6U75_RS04450 (R6U75_04445) - 857668..858225 (+) 558 WP_199875565.1 phage scaffolding protein -
  R6U75_RS04455 (R6U75_04450) - 858238..859146 (+) 909 WP_199875564.1 hypothetical protein -
  R6U75_RS04460 (R6U75_04455) - 859214..859630 (+) 417 WP_199875563.1 hypothetical protein -
  R6U75_RS04465 (R6U75_04460) - 859627..859974 (+) 348 WP_199875562.1 putative minor capsid protein -
  R6U75_RS04470 (R6U75_04465) - 859974..860324 (+) 351 WP_199875561.1 minor capsid protein -
  R6U75_RS04475 (R6U75_04470) - 860311..860706 (+) 396 WP_199875560.1 minor capsid protein -
  R6U75_RS04480 (R6U75_04475) - 860709..861149 (+) 441 Protein_856 phage tail tube protein -
  R6U75_RS04485 (R6U75_04480) - 861358..861795 (+) 438 WP_199875559.1 hypothetical protein -
  R6U75_RS04490 (R6U75_04485) - 861802..862434 (+) 633 WP_199875558.1 Gp15 family bacteriophage protein -
  R6U75_RS04495 (R6U75_04490) - 862438..868014 (+) 5577 WP_199875557.1 glycine zipper domain-containing protein -
  R6U75_RS04500 (R6U75_04495) - 868067..868864 (+) 798 WP_199875556.1 phage tail domain-containing protein -
  R6U75_RS04505 (R6U75_04500) - 868873..870009 (+) 1137 WP_199875555.1 phage tail protein -
  R6U75_RS04510 (R6U75_04505) - 869999..870208 (+) 210 WP_199875554.1 hypothetical protein -
  R6U75_RS04515 (R6U75_04510) - 870314..870610 (+) 297 WP_199875553.1 hypothetical protein -
  R6U75_RS04520 (R6U75_04515) - 870610..872418 (+) 1809 WP_199875552.1 BppU family phage baseplate upper protein -
  R6U75_RS04525 (R6U75_04520) - 872437..873201 (+) 765 WP_199875551.1 hypothetical protein -
  R6U75_RS04530 (R6U75_04525) - 873215..873526 (+) 312 WP_199875550.1 DUF2977 domain-containing protein -
  R6U75_RS04535 (R6U75_04530) - 873526..873657 (+) 132 WP_199875549.1 XkdX family protein -
  R6U75_RS04540 (R6U75_04535) - 873993..874232 (+) 240 WP_199875548.1 phage holin -
  R6U75_RS04545 (R6U75_04540) - 874216..875340 (+) 1125 WP_199875547.1 peptidoglycan recognition family protein -
  R6U75_RS04550 (R6U75_04545) - 876524..877900 (+) 1377 WP_199875546.1 amino acid permease -

Sequence


Protein


Download         Length: 160 a.a.        Molecular weight: 18151.89 Da        Isoelectric Point: 6.4638

>NTDB_id=899499 R6U75_RS04380 WP_199875575.1 848309..848791(+) (ssb) [Pediococcus pentosaceus strain LA0061]
MINRTVLVGRLTNGPELKYTGSGVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKAAENFCNFTHKGSLVGIDGRIQTR
SYDNQQGTRIFVTEVVAENFSLLESKNSNQNNQNEQFEQNRPQNNGQNYQNQQNGQSSHSINPNDPFKSMPDIKDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=899499 R6U75_RS04380 WP_199875575.1 848309..848791(+) (ssb) [Pediococcus pentosaceus strain LA0061]
ATGATTAATCGAACAGTATTAGTCGGGCGGTTAACTAACGGTCCAGAACTAAAATACACAGGCAGCGGTGTAGCAGTTGC
AACCTTCACAGTAGCCGTTAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCAGATTTTATTAGATGCCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAACTTTACTCACAAAGGTTCACTGGTTGGCATCGACGGACGCATTCAAACTCGT
TCATACGATAATCAGCAAGGTACACGAATTTTTGTTACTGAGGTCGTAGCTGAGAACTTCTCGCTACTTGAATCTAAAAA
TAGCAATCAAAATAACCAAAATGAACAATTTGAACAAAATAGACCTCAAAATAATGGACAAAATTATCAGAATCAACAAA
ATGGTCAATCATCACATAGCATAAATCCTAACGACCCATTTAAAAGCATGCCGGATATCAAGGATGACGATTTACCATTC
TAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.471

100

0.6

  ssbA Bacillus subtilis subsp. subtilis str. 168

55.172

100

0.6