Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   R4707_RS02205 Genome accession   NZ_CP137113
Coordinates   419789..420334 (-) Length   181 a.a.
NCBI ID   WP_317830954.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain ZGX     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 388470..441257 419789..420334 within 0


Gene organization within MGE regions


Location: 388470..441257
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4707_RS02025 lytA 388470..389426 (-) 957 WP_317830944.1 N-acetylmuramoyl-L-alanine amidase LytA -
  R4707_RS02030 - 389430..389762 (-) 333 WP_130885414.1 phage holin -
  R4707_RS02035 - 389766..390182 (-) 417 WP_055310877.1 phage holin family protein -
  R4707_RS02040 - 390192..390455 (-) 264 WP_001865331.1 hypothetical protein -
  R4707_RS02045 - 390515..392593 (-) 2079 WP_277771959.1 DUF859 family phage minor structural protein -
  R4707_RS02050 - 392605..398139 (-) 5535 WP_317830945.1 hypothetical protein -
  R4707_RS02055 - 398141..399655 (-) 1515 WP_044812470.1 distal tail protein Dit -
  R4707_RS02060 - 399652..402954 (-) 3303 WP_057548335.1 tape measure protein -
  R4707_RS02065 - 402947..403516 (-) 570 WP_000062053.1 Gp15 family bacteriophage protein -
  R4707_RS02070 - 403529..404017 (-) 489 WP_000129839.1 hypothetical protein -
  R4707_RS02075 - 404082..404531 (-) 450 WP_000198230.1 phage tail tube protein -
  R4707_RS02080 - 404528..404935 (-) 408 WP_001208881.1 minor capsid protein -
  R4707_RS02085 - 404935..405279 (-) 345 WP_000020371.1 minor capsid protein -
  R4707_RS02090 - 405279..405650 (-) 372 WP_000565934.1 putative minor capsid protein -
  R4707_RS02095 - 405640..406032 (-) 393 WP_050096596.1 hypothetical protein -
  R4707_RS02100 - 406075..406308 (-) 234 WP_050202695.1 hypothetical protein -
  R4707_RS02105 - 406319..407200 (-) 882 WP_050297188.1 hypothetical protein -
  R4707_RS02110 - 407218..407781 (-) 564 WP_000896122.1 phage scaffolding protein -
  R4707_RS02115 - 407920..409071 (-) 1152 WP_000730219.1 phage minor capsid protein -
  R4707_RS02120 - 409068..409322 (-) 255 WP_050119042.1 hypothetical protein -
  R4707_RS02125 - 409309..410877 (-) 1569 WP_050119044.1 phage portal protein -
  R4707_RS02130 - 410890..412200 (-) 1311 WP_000143806.1 PBSX family phage terminase large subunit -
  R4707_RS02135 - 412190..412648 (-) 459 WP_001136856.1 KGG domain-containing protein -
  R4707_RS02140 - 412852..413598 (-) 747 WP_000057533.1 hypothetical protein -
  R4707_RS02145 - 413579..414673 (-) 1095 WP_000425573.1 DUF4417 domain-containing protein -
  R4707_RS02150 - 414739..415131 (-) 393 WP_000162611.1 hypothetical protein -
  R4707_RS02155 - 415131..415424 (-) 294 WP_317830949.1 hypothetical protein -
  R4707_RS02160 - 415424..415924 (-) 501 WP_050211861.1 DUF1642 domain-containing protein -
  R4707_RS02165 - 415926..416243 (-) 318 WP_180976110.1 hypothetical protein -
  R4707_RS02170 - 416292..416498 (-) 207 WP_000573750.1 hypothetical protein -
  R4707_RS02175 - 416500..416901 (-) 402 WP_000667209.1 hypothetical protein -
  R4707_RS02180 - 416912..417124 (-) 213 WP_001286809.1 crAss001_48 related protein -
  R4707_RS02185 - 417141..417878 (-) 738 WP_050222008.1 hypothetical protein -
  R4707_RS02190 - 417880..418314 (-) 435 WP_050085608.1 hypothetical protein -
  R4707_RS02195 - 418368..418571 (-) 204 WP_000161128.1 hypothetical protein -
  R4707_RS02200 - 418606..419763 (-) 1158 WP_050225024.1 DNA cytosine methyltransferase -
  R4707_RS02205 ssb 419789..420334 (-) 546 WP_317830954.1 single-stranded DNA-binding protein Machinery gene
  R4707_RS02210 - 420324..420500 (-) 177 WP_001203349.1 hypothetical protein -
  R4707_RS02215 - 420522..421514 (-) 993 WP_050225026.1 DUF1351 domain-containing protein -
  R4707_RS02220 - 421527..421853 (-) 327 WP_001865201.1 hypothetical protein -
  R4707_RS02225 - 421857..422552 (-) 696 WP_001865200.1 ERF family protein -
  R4707_RS02230 - 422558..423010 (-) 453 WP_001134283.1 hypothetical protein -
  R4707_RS02235 - 423094..423360 (-) 267 WP_000450962.1 hypothetical protein -
  R4707_RS02240 - 423593..423856 (-) 264 WP_001814284.1 transcriptional regulator -
  R4707_RS02245 - 424034..424225 (-) 192 WP_001112906.1 helix-turn-helix domain-containing protein -
  R4707_RS02250 - 424522..424884 (+) 363 WP_000464163.1 helix-turn-helix domain-containing protein -
  R4707_RS02255 - 424906..425286 (+) 381 WP_000136431.1 ImmA/IrrE family metallo-endopeptidase -
  R4707_RS02260 - 425304..425819 (+) 516 WP_050201420.1 hypothetical protein -
  R4707_RS02265 - 425937..427064 (+) 1128 WP_000266845.1 site-specific integrase -
  R4707_RS02270 whiA 427152..428063 (-) 912 WP_317830956.1 DNA-binding protein WhiA -
  R4707_RS02275 - 428060..429037 (-) 978 WP_001231095.1 YvcK family protein -
  R4707_RS02280 rapZ 429034..429924 (-) 891 WP_000163031.1 RNase adapter RapZ -
  R4707_RS02285 - 429976..430356 (-) 381 WP_001140412.1 RidA family protein -
  R4707_RS02290 yihA 430367..430954 (-) 588 WP_000422599.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  R4707_RS02295 clpX 430963..432195 (-) 1233 WP_000106346.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  R4707_RS02300 - 432227..432397 (-) 171 WP_000442275.1 hypothetical protein -
  R4707_RS02305 - 432397..432903 (-) 507 WP_023927129.1 dihydrofolate reductase -
  R4707_RS02310 - 433033..433551 (-) 519 WP_000229874.1 DNA starvation/stationary phase protection protein -
  R4707_RS02315 lytC 434047..435552 (-) 1506 WP_078162773.1 choline binding-anchored murein hydrolase LytC -
  R4707_RS02320 tpiA 435590..436348 (-) 759 WP_000087897.1 triose-phosphate isomerase -
  R4707_RS02325 - 436447..437124 (-) 678 WP_000221605.1 DnaD domain-containing protein -
  R4707_RS02330 metA 437133..438077 (-) 945 WP_081542888.1 homoserine O-succinyltransferase -
  R4707_RS02335 - 438259..438771 (-) 513 WP_050200674.1 adenine phosphoribosyltransferase -
  R4707_RS02340 - 438858..439616 (-) 759 WP_001287234.1 class I SAM-dependent methyltransferase -
  R4707_RS02345 - 439834..440004 (+) 171 WP_000403103.1 hypothetical protein -
  R4707_RS02350 - 440127..441257 (-) 1131 WP_000229959.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 181 a.a.        Molecular weight: 20245.13 Da        Isoelectric Point: 6.2288

>NTDB_id=896074 R4707_RS02205 WP_317830954.1 419789..420334(-) (ssb) [Streptococcus pneumoniae strain ZGX]
MINNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREANFINCVIWRQSAENLVNWAKKGSLIGVTGVIQTR
SYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFKNGNSYGQQGSFLEGNTTNLVPDFTR
DNNPFGRPTNPLDISDDDLPF

Nucleotide


Download         Length: 546 bp        

>NTDB_id=896074 R4707_RS02205 WP_317830954.1 419789..420334(-) (ssb) [Streptococcus pneumoniae strain ZGX]
ATGATAAATAACGTTGTTTTAGTAGGGAGACTTACAAGAGATGCCGAACTGAGATACACGCAATCTAATATTGCGGTTGC
TACGTTTACTCTTGCTGTAAACCGTCCATTTAAGAACGAGGCTGGAGAGCGTGAGGCTAATTTTATCAATTGCGTTATCT
GGAGACAGTCAGCTGAAAATCTTGTTAATTGGGCTAAAAAAGGCTCTCTTATCGGAGTTACAGGAGTAATTCAAACACGT
AGCTATGATAACCAGCAAGGTCAACGTGTTTATGTCACAGAAGTTGTTGCCAGTAATTTTCAACTGTTGGAAAGTCGTAA
CAGTCAGCAAAATAATCAAGGTCATCAAGACCATCATGGCGGTTATCAGCAGCAGGGCTACAGTAATCAAGGCAGTTCTT
TCAAAAATGGAAATAGTTACGGGCAACAAGGCAGTTTCCTTGAGGGGAACACAACAAATCTAGTTCCTGATTTCACCCGT
GATAACAATCCATTTGGCAGACCCACAAATCCATTGGATATTAGTGATGATGATTTACCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.044

100

0.564

  ssbA Bacillus subtilis subsp. subtilis str. 168

47.98

100

0.525