Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | R4707_RS02205 | Genome accession | NZ_CP137113 |
| Coordinates | 419789..420334 (-) | Length | 181 a.a. |
| NCBI ID | WP_317830954.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain ZGX | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 388470..441257 | 419789..420334 | within | 0 |
Gene organization within MGE regions
Location: 388470..441257
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R4707_RS02025 | lytA | 388470..389426 (-) | 957 | WP_317830944.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| R4707_RS02030 | - | 389430..389762 (-) | 333 | WP_130885414.1 | phage holin | - |
| R4707_RS02035 | - | 389766..390182 (-) | 417 | WP_055310877.1 | phage holin family protein | - |
| R4707_RS02040 | - | 390192..390455 (-) | 264 | WP_001865331.1 | hypothetical protein | - |
| R4707_RS02045 | - | 390515..392593 (-) | 2079 | WP_277771959.1 | DUF859 family phage minor structural protein | - |
| R4707_RS02050 | - | 392605..398139 (-) | 5535 | WP_317830945.1 | hypothetical protein | - |
| R4707_RS02055 | - | 398141..399655 (-) | 1515 | WP_044812470.1 | distal tail protein Dit | - |
| R4707_RS02060 | - | 399652..402954 (-) | 3303 | WP_057548335.1 | tape measure protein | - |
| R4707_RS02065 | - | 402947..403516 (-) | 570 | WP_000062053.1 | Gp15 family bacteriophage protein | - |
| R4707_RS02070 | - | 403529..404017 (-) | 489 | WP_000129839.1 | hypothetical protein | - |
| R4707_RS02075 | - | 404082..404531 (-) | 450 | WP_000198230.1 | phage tail tube protein | - |
| R4707_RS02080 | - | 404528..404935 (-) | 408 | WP_001208881.1 | minor capsid protein | - |
| R4707_RS02085 | - | 404935..405279 (-) | 345 | WP_000020371.1 | minor capsid protein | - |
| R4707_RS02090 | - | 405279..405650 (-) | 372 | WP_000565934.1 | putative minor capsid protein | - |
| R4707_RS02095 | - | 405640..406032 (-) | 393 | WP_050096596.1 | hypothetical protein | - |
| R4707_RS02100 | - | 406075..406308 (-) | 234 | WP_050202695.1 | hypothetical protein | - |
| R4707_RS02105 | - | 406319..407200 (-) | 882 | WP_050297188.1 | hypothetical protein | - |
| R4707_RS02110 | - | 407218..407781 (-) | 564 | WP_000896122.1 | phage scaffolding protein | - |
| R4707_RS02115 | - | 407920..409071 (-) | 1152 | WP_000730219.1 | phage minor capsid protein | - |
| R4707_RS02120 | - | 409068..409322 (-) | 255 | WP_050119042.1 | hypothetical protein | - |
| R4707_RS02125 | - | 409309..410877 (-) | 1569 | WP_050119044.1 | phage portal protein | - |
| R4707_RS02130 | - | 410890..412200 (-) | 1311 | WP_000143806.1 | PBSX family phage terminase large subunit | - |
| R4707_RS02135 | - | 412190..412648 (-) | 459 | WP_001136856.1 | KGG domain-containing protein | - |
| R4707_RS02140 | - | 412852..413598 (-) | 747 | WP_000057533.1 | hypothetical protein | - |
| R4707_RS02145 | - | 413579..414673 (-) | 1095 | WP_000425573.1 | DUF4417 domain-containing protein | - |
| R4707_RS02150 | - | 414739..415131 (-) | 393 | WP_000162611.1 | hypothetical protein | - |
| R4707_RS02155 | - | 415131..415424 (-) | 294 | WP_317830949.1 | hypothetical protein | - |
| R4707_RS02160 | - | 415424..415924 (-) | 501 | WP_050211861.1 | DUF1642 domain-containing protein | - |
| R4707_RS02165 | - | 415926..416243 (-) | 318 | WP_180976110.1 | hypothetical protein | - |
| R4707_RS02170 | - | 416292..416498 (-) | 207 | WP_000573750.1 | hypothetical protein | - |
| R4707_RS02175 | - | 416500..416901 (-) | 402 | WP_000667209.1 | hypothetical protein | - |
| R4707_RS02180 | - | 416912..417124 (-) | 213 | WP_001286809.1 | crAss001_48 related protein | - |
| R4707_RS02185 | - | 417141..417878 (-) | 738 | WP_050222008.1 | hypothetical protein | - |
| R4707_RS02190 | - | 417880..418314 (-) | 435 | WP_050085608.1 | hypothetical protein | - |
| R4707_RS02195 | - | 418368..418571 (-) | 204 | WP_000161128.1 | hypothetical protein | - |
| R4707_RS02200 | - | 418606..419763 (-) | 1158 | WP_050225024.1 | DNA cytosine methyltransferase | - |
| R4707_RS02205 | ssb | 419789..420334 (-) | 546 | WP_317830954.1 | single-stranded DNA-binding protein | Machinery gene |
| R4707_RS02210 | - | 420324..420500 (-) | 177 | WP_001203349.1 | hypothetical protein | - |
| R4707_RS02215 | - | 420522..421514 (-) | 993 | WP_050225026.1 | DUF1351 domain-containing protein | - |
| R4707_RS02220 | - | 421527..421853 (-) | 327 | WP_001865201.1 | hypothetical protein | - |
| R4707_RS02225 | - | 421857..422552 (-) | 696 | WP_001865200.1 | ERF family protein | - |
| R4707_RS02230 | - | 422558..423010 (-) | 453 | WP_001134283.1 | hypothetical protein | - |
| R4707_RS02235 | - | 423094..423360 (-) | 267 | WP_000450962.1 | hypothetical protein | - |
| R4707_RS02240 | - | 423593..423856 (-) | 264 | WP_001814284.1 | transcriptional regulator | - |
| R4707_RS02245 | - | 424034..424225 (-) | 192 | WP_001112906.1 | helix-turn-helix domain-containing protein | - |
| R4707_RS02250 | - | 424522..424884 (+) | 363 | WP_000464163.1 | helix-turn-helix domain-containing protein | - |
| R4707_RS02255 | - | 424906..425286 (+) | 381 | WP_000136431.1 | ImmA/IrrE family metallo-endopeptidase | - |
| R4707_RS02260 | - | 425304..425819 (+) | 516 | WP_050201420.1 | hypothetical protein | - |
| R4707_RS02265 | - | 425937..427064 (+) | 1128 | WP_000266845.1 | site-specific integrase | - |
| R4707_RS02270 | whiA | 427152..428063 (-) | 912 | WP_317830956.1 | DNA-binding protein WhiA | - |
| R4707_RS02275 | - | 428060..429037 (-) | 978 | WP_001231095.1 | YvcK family protein | - |
| R4707_RS02280 | rapZ | 429034..429924 (-) | 891 | WP_000163031.1 | RNase adapter RapZ | - |
| R4707_RS02285 | - | 429976..430356 (-) | 381 | WP_001140412.1 | RidA family protein | - |
| R4707_RS02290 | yihA | 430367..430954 (-) | 588 | WP_000422599.1 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
| R4707_RS02295 | clpX | 430963..432195 (-) | 1233 | WP_000106346.1 | ATP-dependent Clp protease ATP-binding subunit ClpX | Regulator |
| R4707_RS02300 | - | 432227..432397 (-) | 171 | WP_000442275.1 | hypothetical protein | - |
| R4707_RS02305 | - | 432397..432903 (-) | 507 | WP_023927129.1 | dihydrofolate reductase | - |
| R4707_RS02310 | - | 433033..433551 (-) | 519 | WP_000229874.1 | DNA starvation/stationary phase protection protein | - |
| R4707_RS02315 | lytC | 434047..435552 (-) | 1506 | WP_078162773.1 | choline binding-anchored murein hydrolase LytC | - |
| R4707_RS02320 | tpiA | 435590..436348 (-) | 759 | WP_000087897.1 | triose-phosphate isomerase | - |
| R4707_RS02325 | - | 436447..437124 (-) | 678 | WP_000221605.1 | DnaD domain-containing protein | - |
| R4707_RS02330 | metA | 437133..438077 (-) | 945 | WP_081542888.1 | homoserine O-succinyltransferase | - |
| R4707_RS02335 | - | 438259..438771 (-) | 513 | WP_050200674.1 | adenine phosphoribosyltransferase | - |
| R4707_RS02340 | - | 438858..439616 (-) | 759 | WP_001287234.1 | class I SAM-dependent methyltransferase | - |
| R4707_RS02345 | - | 439834..440004 (+) | 171 | WP_000403103.1 | hypothetical protein | - |
| R4707_RS02350 | - | 440127..441257 (-) | 1131 | WP_000229959.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 181 a.a. Molecular weight: 20245.13 Da Isoelectric Point: 6.2288
>NTDB_id=896074 R4707_RS02205 WP_317830954.1 419789..420334(-) (ssb) [Streptococcus pneumoniae strain ZGX]
MINNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREANFINCVIWRQSAENLVNWAKKGSLIGVTGVIQTR
SYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFKNGNSYGQQGSFLEGNTTNLVPDFTR
DNNPFGRPTNPLDISDDDLPF
MINNVVLVGRLTRDAELRYTQSNIAVATFTLAVNRPFKNEAGEREANFINCVIWRQSAENLVNWAKKGSLIGVTGVIQTR
SYDNQQGQRVYVTEVVASNFQLLESRNSQQNNQGHQDHHGGYQQQGYSNQGSSFKNGNSYGQQGSFLEGNTTNLVPDFTR
DNNPFGRPTNPLDISDDDLPF
Nucleotide
Download Length: 546 bp
>NTDB_id=896074 R4707_RS02205 WP_317830954.1 419789..420334(-) (ssb) [Streptococcus pneumoniae strain ZGX]
ATGATAAATAACGTTGTTTTAGTAGGGAGACTTACAAGAGATGCCGAACTGAGATACACGCAATCTAATATTGCGGTTGC
TACGTTTACTCTTGCTGTAAACCGTCCATTTAAGAACGAGGCTGGAGAGCGTGAGGCTAATTTTATCAATTGCGTTATCT
GGAGACAGTCAGCTGAAAATCTTGTTAATTGGGCTAAAAAAGGCTCTCTTATCGGAGTTACAGGAGTAATTCAAACACGT
AGCTATGATAACCAGCAAGGTCAACGTGTTTATGTCACAGAAGTTGTTGCCAGTAATTTTCAACTGTTGGAAAGTCGTAA
CAGTCAGCAAAATAATCAAGGTCATCAAGACCATCATGGCGGTTATCAGCAGCAGGGCTACAGTAATCAAGGCAGTTCTT
TCAAAAATGGAAATAGTTACGGGCAACAAGGCAGTTTCCTTGAGGGGAACACAACAAATCTAGTTCCTGATTTCACCCGT
GATAACAATCCATTTGGCAGACCCACAAATCCATTGGATATTAGTGATGATGATTTACCGTTTTAG
ATGATAAATAACGTTGTTTTAGTAGGGAGACTTACAAGAGATGCCGAACTGAGATACACGCAATCTAATATTGCGGTTGC
TACGTTTACTCTTGCTGTAAACCGTCCATTTAAGAACGAGGCTGGAGAGCGTGAGGCTAATTTTATCAATTGCGTTATCT
GGAGACAGTCAGCTGAAAATCTTGTTAATTGGGCTAAAAAAGGCTCTCTTATCGGAGTTACAGGAGTAATTCAAACACGT
AGCTATGATAACCAGCAAGGTCAACGTGTTTATGTCACAGAAGTTGTTGCCAGTAATTTTCAACTGTTGGAAAGTCGTAA
CAGTCAGCAAAATAATCAAGGTCATCAAGACCATCATGGCGGTTATCAGCAGCAGGGCTACAGTAATCAAGGCAGTTCTT
TCAAAAATGGAAATAGTTACGGGCAACAAGGCAGTTTCCTTGAGGGGAACACAACAAATCTAGTTCCTGATTTCACCCGT
GATAACAATCCATTTGGCAGACCCACAAATCCATTGGATATTAGTGATGATGATTTACCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.044 |
100 |
0.564 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.98 |
100 |
0.525 |