Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4712_RS02830 Genome accession   NZ_CP137110
Coordinates   569612..569761 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 16H2041     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 564612..574761
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4712_RS02795 ccrZ 564792..565586 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  R4712_RS02800 - 565747..566358 (-) 612 WP_000394036.1 CPBP family intramembrane glutamic endopeptidase -
  R4712_RS02805 blpZ 566509..566742 (-) 234 WP_000276498.1 immunity protein BlpZ -
  R4712_RS02810 - 566784..567473 (-) 690 WP_000760523.1 CPBP family intramembrane glutamic endopeptidase -
  R4712_RS02815 - 567525..567908 (-) 384 WP_016398494.1 hypothetical protein -
  R4712_RS02820 - 568537..568869 (-) 333 WP_224757293.1 immunity protein -
  R4712_RS02825 - 569389..569508 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4712_RS10850 - 569511..569576 (-) 66 Protein_564 ComC/BlpC family peptide pheromone/bacteriocin -
  R4712_RS02830 cipB 569612..569761 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R4712_RS02835 blpK 570005..570253 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  R4712_RS02840 blpJ 570322..570591 (-) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  R4712_RS02845 blpI 571058..571255 (-) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  R4712_RS02850 comA/nlmT 571537..572124 (+) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  R4712_RS02855 comA/nlmT 572051..573616 (+) 1566 WP_308410653.1 peptide cleavage/export ABC transporter Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=895845 R4712_RS02830 WP_001809846.1 569612..569761(-) (cipB) [Streptococcus pneumoniae strain 16H2041]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=895845 R4712_RS02830 WP_001809846.1 569612..569761(-) (cipB) [Streptococcus pneumoniae strain 16H2041]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531