Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R4704_RS08245 Genome accession   NZ_CP137109
Coordinates   1579195..1579344 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 11012     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1574195..1584344
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R4704_RS08215 blpC 1574398..1574553 (-) 156 WP_000358814.1 quorum-sensing system pheromone BlpC -
  R4704_RS08220 - 1574610..1575971 (-) 1362 WP_033705510.1 bacteriocin secretion accessory protein -
  R4704_RS08225 comA/nlmT 1575982..1577658 (-) 1677 WP_317830619.1 peptide cleavage/export ABC transporter Regulator
  R4704_RS08230 comA/nlmT 1577552..1578139 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  R4704_RS08235 blpM 1578478..1578732 (+) 255 WP_033705509.1 two-peptide bacteriocin subunit BlpM -
  R4704_RS08240 blpN 1578748..1578951 (+) 204 WP_001099490.1 two-peptide bacteriocin subunit BlpN -
  R4704_RS08245 cipB 1579195..1579344 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  R4704_RS08250 - 1579448..1579567 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  R4704_RS08255 - 1580035..1580406 (+) 372 WP_033705507.1 hypothetical protein -
  R4704_RS08260 - 1580567..1581536 (+) 970 Protein_1586 thioredoxin domain-containing protein -
  R4704_RS08265 - 1581783..1582016 (+) 234 WP_033705506.1 bacteriocin class II family protein -
  R4704_RS08270 - 1582048..1582737 (+) 690 WP_033705505.1 CPBP family intramembrane glutamic endopeptidase -
  R4704_RS08275 blpZ 1582779..1583027 (+) 249 WP_000276506.1 immunity protein BlpZ -
  R4704_RS08280 - 1583057..1583668 (+) 612 WP_000394042.1 CPBP family intramembrane glutamic endopeptidase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=895824 R4704_RS08245 WP_001809846.1 1579195..1579344(+) (cipB) [Streptococcus pneumoniae strain 11012]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=895824 R4704_RS08245 WP_001809846.1 1579195..1579344(+) (cipB) [Streptococcus pneumoniae strain 11012]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531