Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   R3Y73_RS02570 Genome accession   NZ_CP137015
Coordinates   577597..577911 (-) Length   104 a.a.
NCBI ID   WP_077722594.1    Uniprot ID   -
Organism   Bacillus velezensis strain CYS06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 572597..582911
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R3Y73_RS02525 (R3Y73_02525) sinI 573280..573453 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  R3Y73_RS02530 (R3Y73_02530) sinR 573487..573822 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  R3Y73_RS02535 (R3Y73_02535) tasA 573870..574655 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  R3Y73_RS02540 (R3Y73_02540) sipW 574719..575303 (-) 585 WP_012117977.1 signal peptidase I SipW -
  R3Y73_RS02545 (R3Y73_02545) tapA 575275..575946 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  R3Y73_RS02550 (R3Y73_02550) - 576205..576534 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  R3Y73_RS02555 (R3Y73_02555) - 576574..576753 (-) 180 WP_003153093.1 YqzE family protein -
  R3Y73_RS02560 (R3Y73_02560) comGG 576810..577187 (-) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  R3Y73_RS02565 (R3Y73_02565) comGF 577188..577583 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  R3Y73_RS02570 (R3Y73_02570) comGE 577597..577911 (-) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  R3Y73_RS02575 (R3Y73_02575) comGD 577895..578332 (-) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  R3Y73_RS02580 (R3Y73_02580) comGC 578322..578630 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  R3Y73_RS02585 (R3Y73_02585) comGB 578635..579672 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  R3Y73_RS02590 (R3Y73_02590) comGA 579659..580729 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  R3Y73_RS02595 (R3Y73_02595) - 580921..581871 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11860.84 Da        Isoelectric Point: 6.9470

>NTDB_id=894315 R3Y73_RS02570 WP_077722594.1 577597..577911(-) (comGE) [Bacillus velezensis strain CYS06]
MLNGNKGFSTIETLSAMSIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=894315 R3Y73_RS02570 WP_077722594.1 577597..577911(-) (comGE) [Bacillus velezensis strain CYS06]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGTCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49