Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   R3Y73_RS02525 Genome accession   NZ_CP137015
Coordinates   573280..573453 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CYS06     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 568280..578453
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R3Y73_RS02510 (R3Y73_02510) gcvT 569097..570197 (-) 1101 WP_176283424.1 glycine cleavage system aminomethyltransferase GcvT -
  R3Y73_RS02515 (R3Y73_02515) - 570621..572291 (+) 1671 WP_060562612.1 DEAD/DEAH box helicase -
  R3Y73_RS02520 (R3Y73_02520) - 572309..573103 (+) 795 WP_014305407.1 YqhG family protein -
  R3Y73_RS02525 (R3Y73_02525) sinI 573280..573453 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  R3Y73_RS02530 (R3Y73_02530) sinR 573487..573822 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  R3Y73_RS02535 (R3Y73_02535) tasA 573870..574655 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  R3Y73_RS02540 (R3Y73_02540) sipW 574719..575303 (-) 585 WP_012117977.1 signal peptidase I SipW -
  R3Y73_RS02545 (R3Y73_02545) tapA 575275..575946 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  R3Y73_RS02550 (R3Y73_02550) - 576205..576534 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  R3Y73_RS02555 (R3Y73_02555) - 576574..576753 (-) 180 WP_003153093.1 YqzE family protein -
  R3Y73_RS02560 (R3Y73_02560) comGG 576810..577187 (-) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  R3Y73_RS02565 (R3Y73_02565) comGF 577188..577583 (-) 396 WP_077722593.1 competence type IV pilus minor pilin ComGF -
  R3Y73_RS02570 (R3Y73_02570) comGE 577597..577911 (-) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  R3Y73_RS02575 (R3Y73_02575) comGD 577895..578332 (-) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=894312 R3Y73_RS02525 WP_003153105.1 573280..573453(+) (sinI) [Bacillus velezensis strain CYS06]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=894312 R3Y73_RS02525 WP_003153105.1 573280..573453(+) (sinI) [Bacillus velezensis strain CYS06]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702