Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   RJD36_RS05065 Genome accession   NZ_CP136943
Coordinates   967248..967688 (+) Length   146 a.a.
NCBI ID   WP_061100410.1    Uniprot ID   A0AAW6YA73
Organism   Streptococcus pasteurianus strain WUSP082     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 951714..972954 967248..967688 within 0


Gene organization within MGE regions


Location: 951714..972954
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RJD36_RS04990 (RJD36_04990) - 952499..952879 (+) 381 WP_003065285.1 DUF1149 family protein -
  RJD36_RS04995 (RJD36_04995) - 952879..953727 (+) 849 WP_003065283.1 DegV family protein -
  RJD36_RS05000 (RJD36_05000) dapB 953747..954514 (+) 768 WP_003065282.1 4-hydroxy-tetrahydrodipicolinate reductase -
  RJD36_RS05005 (RJD36_05005) - 954511..955716 (+) 1206 WP_003065280.1 CCA tRNA nucleotidyltransferase -
  RJD36_RS05010 (RJD36_05010) - 955713..957584 (+) 1872 WP_317751488.1 ABC-F family ATP-binding cassette domain-containing protein -
  RJD36_RS05015 (RJD36_05015) - 957663..959402 (+) 1740 WP_003065277.1 ABC transporter ATP-binding protein -
  RJD36_RS05020 (RJD36_05020) - 959405..961174 (+) 1770 WP_013851968.1 ABC transporter ATP-binding protein -
  RJD36_RS05025 (RJD36_05025) queC 961425..962078 (+) 654 WP_013851967.1 7-cyano-7-deazaguanine synthase QueC -
  RJD36_RS05030 (RJD36_05030) queD 962078..962524 (+) 447 WP_003065271.1 6-carboxytetrahydropterin synthase QueD -
  RJD36_RS05035 (RJD36_05035) queE 962517..963230 (+) 714 WP_003065269.1 7-carboxy-7-deazaguanine synthase QueE -
  RJD36_RS05040 (RJD36_05040) queF 963243..963734 (+) 492 WP_003065267.1 preQ(1) synthase -
  RJD36_RS05045 (RJD36_05045) - 963790..964287 (-) 498 WP_003065265.1 DUF308 domain-containing protein -
  RJD36_RS05050 (RJD36_05050) gdhA 964533..965882 (+) 1350 WP_003065263.1 NADP-specific glutamate dehydrogenase -
  RJD36_RS05055 (RJD36_05055) - 966159..966668 (+) 510 WP_117479609.1 GNAT family N-acetyltransferase -
  RJD36_RS05060 (RJD36_05060) - 966665..967075 (+) 411 WP_003065257.1 peptide deformylase -
  RJD36_RS05065 (RJD36_05065) rcrR 967248..967688 (+) 441 WP_061100410.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  RJD36_RS05070 (RJD36_05070) rcrP 967692..969506 (+) 1815 WP_117479607.1 ABC transporter ATP-binding protein Regulator
  RJD36_RS05075 (RJD36_05075) rcrQ 969496..971268 (+) 1773 WP_058692202.1 ABC transporter ATP-binding protein Regulator
  RJD36_RS05080 (RJD36_05080) - 971535..972512 (+) 978 WP_117479603.1 alcohol dehydrogenase catalytic domain-containing protein -
  RJD36_RS05085 (RJD36_05085) - 972502..972954 (+) 453 WP_003065246.1 MarR family winged helix-turn-helix transcriptional regulator -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 17085.55 Da        Isoelectric Point: 9.3733

>NTDB_id=893545 RJD36_RS05065 WP_061100410.1 967248..967688(+) (rcrR) [Streptococcus pasteurianus strain WUSP082]
MHKKDPFSQFRDFINLAENRVHALAESHGVENLAGPQGFAVLYLHDNPDKEIYIKDIEKRLRISKSVTSNLIKRMEKNGF
IRVISSIEDKRYKQVVLTELGKSKAQNIQDFHDEMHRQILAGVDHEDLKISFRVFDRILKNLENKE

Nucleotide


Download         Length: 441 bp        

>NTDB_id=893545 RJD36_RS05065 WP_061100410.1 967248..967688(+) (rcrR) [Streptococcus pasteurianus strain WUSP082]
ATGCATAAGAAAGATCCGTTTTCACAGTTTAGGGATTTTATCAATTTAGCGGAAAATCGTGTCCATGCTCTTGCGGAAAG
TCATGGTGTTGAAAATCTGGCTGGTCCACAGGGATTTGCAGTGTTGTATCTCCATGATAATCCTGATAAAGAAATTTATA
TCAAGGATATTGAGAAGAGACTAAGAATTTCAAAGTCAGTAACTAGTAATTTGATTAAGCGCATGGAGAAAAATGGTTTT
ATCCGAGTTATTTCGTCAATAGAAGATAAGCGTTATAAGCAAGTGGTGTTGACTGAACTTGGAAAATCAAAGGCTCAAAA
CATTCAAGATTTCCATGATGAAATGCATAGACAAATCTTAGCTGGTGTTGACCATGAGGATCTCAAAATTTCGTTTCGCG
TCTTTGACCGCATTTTGAAAAATTTAGAAAACAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(35-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

56.643

97.945

0.555