Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RZ534_RS15390 Genome accession   NZ_CP136643
Coordinates   2949317..2949457 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain RS1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2944317..2954457
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RZ534_RS15365 (RZ534_15365) - 2944639..2945028 (-) 390 WP_008345855.1 hotdog fold thioesterase -
  RZ534_RS15370 (RZ534_15370) comA 2945052..2945693 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  RZ534_RS15375 (RZ534_15375) comP 2945774..2948080 (-) 2307 WP_079920597.1 ATP-binding protein Regulator
  RZ534_RS15380 (RZ534_15380) comX 2948094..2948264 (-) 171 WP_017358941.1 competence pheromone ComX -
  RZ534_RS15385 (RZ534_15385) - 2948242..2949165 (-) 924 WP_317327946.1 polyprenyl synthetase family protein -
  RZ534_RS15390 (RZ534_15390) degQ 2949317..2949457 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  RZ534_RS15395 (RZ534_15395) - 2949963..2950316 (+) 354 WP_019744042.1 hypothetical protein -
  RZ534_RS15400 (RZ534_15400) - 2950353..2951579 (-) 1227 WP_058213657.1 EAL and HDOD domain-containing protein -
  RZ534_RS15405 (RZ534_15405) - 2951719..2953188 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  RZ534_RS15410 (RZ534_15410) - 2953206..2953757 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  RZ534_RS15415 (RZ534_15415) - 2953818..2954225 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=892153 RZ534_RS15390 WP_003213123.1 2949317..2949457(-) (degQ) [Bacillus altitudinis strain RS1]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=892153 RZ534_RS15390 WP_003213123.1 2949317..2949457(-) (degQ) [Bacillus altitudinis strain RS1]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696