Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   RAS18_RS15755 Genome accession   NZ_CP136635
Coordinates   3136533..3136676 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus subsp. globigii strain Hab-5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3131533..3141676
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RAS18_RS15730 - 3131813..3132193 (-) 381 WP_061570551.1 hotdog fold thioesterase -
  RAS18_RS15735 comA 3132211..3132852 (-) 642 WP_061570552.1 response regulator transcription factor Regulator
  RAS18_RS15740 - 3132933..3135246 (-) 2314 Protein_3042 ATP-binding protein -
  RAS18_RS15745 comX 3135262..3135483 (-) 222 WP_063637894.1 competence pheromone ComX -
  RAS18_RS15750 - 3135480..3136349 (-) 870 WP_063638377.1 polyprenyl synthetase family protein -
  RAS18_RS15755 degQ 3136533..3136676 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  RAS18_RS15760 - 3137136..3137495 (+) 360 WP_061570555.1 hypothetical protein -
  RAS18_RS15765 - 3137514..3138746 (-) 1233 WP_406620828.1 EAL and HDOD domain-containing protein -
  RAS18_RS15770 - 3138884..3140350 (-) 1467 WP_406620829.1 nicotinate phosphoribosyltransferase -
  RAS18_RS15775 - 3140366..3140917 (-) 552 WP_106045491.1 cysteine hydrolase family protein -
  RAS18_RS15780 - 3141025..3141423 (-) 399 WP_003327144.1 YueI family protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=892058 RAS18_RS15755 WP_003327149.1 3136533..3136676(-) (degQ) [Bacillus atrophaeus subsp. globigii strain Hab-5]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=892058 RAS18_RS15755 WP_003327149.1 3136533..3136676(-) (degQ) [Bacillus atrophaeus subsp. globigii strain Hab-5]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894