Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   RYX39_RS12730 Genome accession   NZ_CP136430
Coordinates   2488672..2489046 (-) Length   124 a.a.
NCBI ID   WP_188323133.1    Uniprot ID   -
Organism   Bacillus halotolerans strain Q2H2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2483672..2494046
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RYX39_RS12690 (RYX39_12690) - 2484013..2484807 (+) 795 WP_127696773.1 YqhG family protein -
  RYX39_RS12695 (RYX39_12695) sinI 2484991..2485164 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  RYX39_RS12700 (RYX39_12700) sinR 2485198..2485533 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RYX39_RS12705 (RYX39_12705) tasA 2485620..2486405 (-) 786 WP_316961079.1 biofilm matrix protein TasA -
  RYX39_RS12710 (RYX39_12710) sipW 2486470..2487054 (-) 585 WP_105955579.1 signal peptidase I SipW -
  RYX39_RS12715 (RYX39_12715) tapA 2487026..2487787 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  RYX39_RS12720 (RYX39_12720) - 2488055..2488378 (+) 324 WP_101864527.1 YqzG/YhdC family protein -
  RYX39_RS12725 (RYX39_12725) - 2488421..2488600 (-) 180 WP_003236949.1 YqzE family protein -
  RYX39_RS12730 (RYX39_12730) comGG 2488672..2489046 (-) 375 WP_188323133.1 competence type IV pilus minor pilin ComGG Machinery gene
  RYX39_RS12735 (RYX39_12735) comGF 2489047..2489466 (-) 420 WP_316961080.1 competence type IV pilus minor pilin ComGF Machinery gene
  RYX39_RS12740 (RYX39_12740) comGE 2489456..2489803 (-) 348 WP_151175142.1 competence type IV pilus minor pilin ComGE Machinery gene
  RYX39_RS12745 (RYX39_12745) comGD 2489787..2490218 (-) 432 WP_151175143.1 competence type IV pilus minor pilin ComGD Machinery gene
  RYX39_RS12750 (RYX39_12750) comGC 2490208..2490504 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  RYX39_RS12755 (RYX39_12755) comGB 2490518..2491555 (-) 1038 WP_151175144.1 competence type IV pilus assembly protein ComGB Machinery gene
  RYX39_RS12760 (RYX39_12760) comGA 2491542..2492612 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  RYX39_RS12765 (RYX39_12765) - 2492933..2493343 (-) 411 WP_106020097.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14511.65 Da        Isoelectric Point: 9.5334

>NTDB_id=891035 RYX39_RS12730 WP_188323133.1 2488672..2489046(-) (comGG) [Bacillus halotolerans strain Q2H2]
MYYSKGFIYPAVLFTFALVMLIVNFTAPQFVSRHMFEQETKEYYTGENLLQNGALLSIRHILEHRPGRKGSQQFQYGHVS
YDIRKKTIKEQQEITLKAITESGTEKSAQLLFDQNQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=891035 RYX39_RS12730 WP_188323133.1 2488672..2489046(-) (comGG) [Bacillus halotolerans strain Q2H2]
ATGTACTACTCAAAAGGGTTTATCTATCCGGCCGTTCTTTTTACATTTGCCCTTGTGATGCTGATTGTGAATTTCACCGC
CCCTCAATTTGTTTCACGCCATATGTTTGAGCAGGAAACAAAAGAGTATTACACAGGAGAAAATCTGCTGCAAAATGGCG
CGCTTCTATCCATCAGGCATATACTTGAGCACAGACCAGGCCGAAAGGGTTCACAGCAGTTTCAATATGGACATGTATCT
TATGACATTCGCAAAAAAACCATAAAAGAACAGCAAGAAATCACTCTTAAAGCCATCACAGAGTCGGGAACAGAAAAAAG
CGCTCAGCTGCTGTTCGATCAAAATCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(31-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

67.742

100

0.677