Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   RX583_RS13405 Genome accession   NZ_CP136402
Coordinates   2557912..2558295 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2552912..2563295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RX583_RS13365 (RX583_13365) sinI 2553846..2554019 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  RX583_RS13370 (RX583_13370) sinR 2554053..2554388 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  RX583_RS13375 (RX583_13375) tasA 2554481..2555266 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  RX583_RS13380 (RX583_13380) sipW 2555330..2555902 (-) 573 WP_003246088.1 signal peptidase I SipW -
  RX583_RS13385 (RX583_13385) tapA 2555886..2556647 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  RX583_RS13390 (RX583_13390) yqzG 2556919..2557245 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  RX583_RS13395 (RX583_13395) spoIITA 2557287..2557466 (-) 180 WP_003230176.1 YqzE family protein -
  RX583_RS13400 (RX583_13400) comGG 2557537..2557911 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  RX583_RS13405 (RX583_13405) comGF 2557912..2558295 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  RX583_RS13410 (RX583_13410) comGE 2558321..2558668 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  RX583_RS13415 (RX583_13415) comGD 2558652..2559083 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  RX583_RS13420 (RX583_13420) comGC 2559073..2559369 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  RX583_RS13425 (RX583_13425) comGB 2559383..2560420 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  RX583_RS13430 (RX583_13430) comGA 2560407..2561477 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  RX583_RS13435 (RX583_13435) corA 2561889..2562842 (-) 954 WP_032723504.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=890697 RX583_RS13405 WP_003230168.1 2557912..2558295(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=890697 RX583_RS13405 WP_003230168.1 2557912..2558295(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1